StarFunc result for job id Q9NRE2

User Input

>input (1034 residues)
MPRRKQQAPKRAAGYAQEEQLKEEEEIKEEEEEEDSGSVAQLQGGNDTGTDEELETGPEQ
KGCFSYQNSPGSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHN
CMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSKSLQQN
LPSRSVSKPSLFSSVQLYRQSSKMCGTVFTGASRFRCRQCSAAYDTLVELTVHMNETGHY
QDDNRKKDKLRPTSYSKPRKRAFQDMDKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHY
QKVPLKEPVPTISSKMVTPAKKRVFDVNRPCSPDSTTGSFADSFSSQKNANLQLSSNNRY
GYQNGASYTWQFEACKSQILKCMECGSSHDTLQQLTTHMMVTGHFLKVTSSASKKGKQLV
LDPLAVEKMQSLSEAPNSDSLAPKPSSNSASDCTASTTELKKESKKERPEETSKDEKVVK
SEDYEDPLQKPLDPTIKYQYLREEDLEDGSKGGGDILKSLENTVTTAINKAQNGAPSWSA
YPSIHAAYQLSEGTKPPLPMGSQVLQIRPNLTNKLRPIAPKWKVMPLVSMPTHLAPYTQV
KKESEDKDEAVKECGKESPHEEASSFSHSEGDSFRKSETPPEAKKTELGPLKEEEKLMKE
GSEKEKPQPLEPTSALSNGCALANHAPALPCINPLSALQSVLNNHLGKATEPLRSPSCSS
PSSSTISMFHKSNLNVMDKPVLSPASTRSASVSRRYLFENSDQPIDLTKSKSKKAESSQA
QSCMSPPQKHALSDIADMVKVLPKATTPKPASSSRVPPMKLEMDVRRFEDVSSEVSTLHK
RKGRQSNWNPQHLLILQAQFASSLFQTSEGKYLLSDLGPQERMQISKFTGLSMTTISHWL
ANVKYQLRKTGGTKFLKNMDKGHPIFYCSDCASQFRTPSTYISHLESHLGFQMKDMTRLS
VDQQSKVEQEISRVSSAQRSPETIAAEEDTDSKFKCKLCCRTFVSKHAVKLHLSKTHSKS
PEHHSQFVTDVDEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRE2	1.000	1.000	0.000	1034	1.000	1.000	Q9NRE2.pdb.gz	TSH2_HUMAN Teashirt homolog 2 OS=Homo sapiens OX=9606 GN=TSHZ2 PE=1 SV=3
2	AFDB:F1QV43	0.311	0.314	8.988E-90	1020	0.580	0.588	F1QV43.pdb.gz	F1QV43_DANRE Teashirt homolog 2 isoform X2 OS=Danio rerio OX=7955 GN=tshz2 PE=3 SV=3
3	AFDB:Q63HK5	0.172	0.166	4.887E-75	1081	0.485	0.463	Q63HK5.pdb.gz	TSH3_HUMAN Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2
4	AFDB:Q8NAP3	0.055	0.050	2.847E-6	1195	0.135	0.117	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
5	AFDB:Q13029	0.055	0.039	1.504E-4	1718	0.148	0.089	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
6	AFDB:A2A7B5	0.052	0.037	1.920E-3	1709	0.164	0.099	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
7	AFDB:Q9USW1	0.047	0.058	2.161E-3	791	0.096	0.125	Q9USW1.pdb.gz	ATH1_SCHPO Ataxin-2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ath1 PE=1 SV=1
8	AFDB:A0A1D8PD52	0.037	0.032	2.738E-3	1287	0.114	0.092	A0A1D8PD52.pdb.gz	A0A1D8PD52_CANAL Msb1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB1 PE=4 SV=1
9	AFDB:O75362	0.056	0.056	2.905E-3	1048	0.123	0.121	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
10	AFDB:P50111	0.066	0.072	8.950E-3	915	0.117	0.132	P50111.pdb.gz	ZDS1_YEAST Protein ZDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZDS1 PE=1 SV=1
11	PDB:2cyyA	0.049	0.248	9.507E-1	151	0.015	0.099	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
12	PDB:2hi3A	0.048	0.536	1.278	73	0.011	0.151	2hi3A.pdb.gz
13	PDB:6c0fD	0.040	0.167	2.053	190	0.015	0.084	6c0fD.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
14	PDB:7mq8LT	0.043	0.049	2.053	869	0.027	0.032	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6gejS	0.047	0.166	2.178	208	0.029	0.144	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:7tnxA	0.028	0.041	2.452	647	0.009	0.014	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
17	PDB:7fbyA	0.049	0.244	2.601	153	0.009	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
18	PDB:4btsA9	0.035	0.163	3.297	93	0.020	0.226	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
19	PDB:4it3A	0.033	0.122	3.498	219	0.011	0.050	4it3A.pdb.gz
20	PDB:5x6uA	0.038	0.224	3.498	124	0.014	0.113	5x6uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0SNQ7	0.0	814	1004	0.478	0.492	A0SNQ7_XENLA Teashirt zinc finger homeobox 3 L homeolog OS=Xenopus laevis OX=8355 GN=tshz3.L PE=1 SV=1
2	D3ZKB9	0.0	843	1072	0.486	0.469	TSH3_RAT Teashirt homolog 3 OS=Rattus norvegicus OX=10116 GN=Tshz3 PE=1 SV=2
3	F1QV43	0.0	1107	1020	0.603	0.611	F1QV43_DANRE Teashirt homolog 2 isoform X2 OS=Danio rerio OX=7955 GN=tshz2 PE=3 SV=3
4	Q5DTH5	0.0	956	1084	0.539	0.514	TSH1_MOUSE Teashirt homolog 1 OS=Mus musculus OX=10090 GN=Tshz1 PE=1 SV=2
5	Q63HK5	0.0	876	1081	0.520	0.498	TSH3_HUMAN Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2
6	Q68FE9	0.0	1814	1030	0.902	0.906	TSH2_MOUSE Teashirt homolog 2 OS=Mus musculus OX=10090 GN=Tshz2 PE=1 SV=1
7	Q6ZSZ6	0.0	971	1077	0.541	0.519	TSH1_HUMAN Teashirt homolog 1 OS=Homo sapiens OX=9606 GN=TSHZ1 PE=1 SV=2
8	Q8CGV9	0.0	865	1081	0.517	0.495	TSH3_MOUSE Teashirt homolog 3 OS=Mus musculus OX=10090 GN=Tshz3 PE=1 SV=2
9	Q9NRE2	0.0	2145	1034	1.000	1.000	TSH2_HUMAN Teashirt homolog 2 OS=Homo sapiens OX=9606 GN=TSHZ2 PE=1 SV=3
10	P22265	4.22e-07	56.6	954	0.029	0.031	TSH_DROME Protein teashirt OS=Drosophila melanogaster OX=7227 GN=tsh PE=1 SV=2
11	Q9U3V5	5.06e-06	53.1	1024	0.046	0.047	TIPT_DROME Protein tiptop OS=Drosophila melanogaster OX=7227 GN=tio PE=2 SV=2
12	Q96GC6	0.009	42.4	653	0.031	0.049	ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens OX=9606 GN=ZNF274 PE=1 SV=2
13	P07664	0.052	39.7	433	0.036	0.085	SRYD_DROME Serendipity locus protein delta OS=Drosophila melanogaster OX=7227 GN=Sry-delta PE=1 SV=2
14	Q9Y3M9	0.081	39.3	751	0.032	0.044	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
15	Q9BYN7	0.12	38.9	854	0.020	0.025	ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens OX=9606 GN=ZNF341 PE=1 SV=2
16	Q8NAP3	0.18	38.1	1195	0.032	0.028	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
17	Q923B3	0.19	38.1	828	0.030	0.037	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
18	J3KTI4	0.24	37.7	1091	0.028	0.027	J3KTI4_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
19	B7ZRU9	0.30	37.7	1055	0.057	0.056	EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis OX=8355 GN=mecom-a PE=1 SV=1
20	A0A0B4JD76	0.31	37.7	1366	0.026	0.020	A0A0B4JD76_DROME O/E-associated zinc finger protein, isoform C OS=Drosophila melanogaster OX=7227 GN=L PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	8.5	18.2	Zinc finger, C2H2 type
2	PF12756 zf-C2H2_2	1.6e-05	36.5	C2H2 type zinc-finger (2 copies)
3	PF18868 zf-C2H2_3rep	0.025	26.7	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	1.2e-05	36.7	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	43	15.5	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	25	16.5	Zinc-finger double-stranded RNA-binding
7	PF16278 zf-C2HE	4.3e+02	12.8	C2HE / C2H2 / C2HC zinc-binding finger
8	PF12874 zf-met	14	17.5	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000453793	0.729	Homeobox protein Meis2
2	9606.ENSP00000272369	0.706	Homeobox protein Meis1
3	9606.ENSP00000351642	0.694	Belongs to the cappuccino family
4	9606.ENSP00000298282	0.692	Homeobox protein PKNOX2
5	9606.ENSP00000442682	0.666	Arf-GAP with dual PH domain-containing protein 1
6	9606.ENSP00000222726	0.606	Homeobox protein Hox-A5
7	9606.ENSP00000361602	0.601	Zinc finger protein 503
8	9606.ENSP00000262593	0.596	Docking protein 5
9	9606.ENSP00000324701	0.573	Protein mab-21-like 2
10	9606.ENSP00000474487	0.560	LIX1-like protein
11	9606.ENSP00000483486	0.555	ADP-ribosylation factor-related protein 1
12	9606.ENSP00000281924	0.546	Transmembrane protein 163
13	9606.ENSP00000258302	0.545	Regulator of G-protein signaling 8
14	9606.ENSP00000360526	0.535	Zinc finger protein 217
15	9606.ENSP00000484928	0.533	Cadherin-4
16	9606.ENSP00000370224	0.518	Prostate androgen-regulated mucin-like protein 1
17	9606.ENSP00000435509	0.517	Zinc finger protein ZIC 4
18	9606.ENSP00000320957	0.503	Transcription cofactor vestigial-like protein 2
19	9606.ENSP00000482245	0.503	Dachshund homolog 1
20	9606.ENSP00000274382	0.502	Protein limb expression 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.405	heterocyclic compound binding
GO:0003676	0.404	nucleic acid binding
GO:0003677	0.373	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050789	0.982	regulation of biological process
GO:0019222	0.948	regulation of metabolic process
GO:0060255	0.916	regulation of macromolecule metabolic process
GO:0050794	0.848	regulation of cellular process
GO:0010468	0.793	regulation of gene expression
GO:0051171	0.580	regulation of nitrogen compound metabolic process
GO:0032502	0.552	developmental process
GO:0032501	0.550	multicellular organismal process
GO:0080090	0.546	regulation of primary metabolic process
GO:0048856	0.537	anatomical structure development
GO:0031323	0.520	regulation of cellular metabolic process
GO:0007275	0.441	multicellular organism development
GO:0009889	0.432	regulation of biosynthetic process
GO:0019219	0.410	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.404	regulation of macromolecule biosynthetic process
GO:0031326	0.389	regulation of cellular biosynthetic process
GO:0051252	0.385	regulation of RNA metabolic process
GO:2001141	0.375	regulation of RNA biosynthetic process
GO:0009987	0.367	cellular process
GO:0006355	0.367	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.995	cytoplasm
GO:0016020	0.993	membrane
GO:0071944	0.981	cell periphery
GO:0005886	0.934	plasma membrane
GO:0005739	0.448	mitochondrion
GO:0005829	0.432	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]