StarFunc result for job id Q9NRF9

User Input

>input (147 residues)
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD
KSRDEDNDEDEERLEEEEQNEEEEVDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRF9	1.000	1.000	1.766E-19	147	1.000	1.000	Q9NRF9.pdb.gz	DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1
2	AFDB:Q9V444	0.715	0.819	9.192E-10	128	0.388	0.445	Q9V444.pdb.gz	DPOE3_DROME DNA polymerase epsilon subunit 3 OS=Drosophila melanogaster OX=7227 GN=Chrac-14 PE=1 SV=1
3	AFDB:Q9FGJ3	0.589	0.459	1.815E-8	190	0.245	0.189	Q9FGJ3.pdb.gz	NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana OX=3702 GN=NFYB2 PE=1 SV=1
4	AFDB:Q9SLG0	0.628	0.653	1.937E-8	141	0.259	0.270	Q9SLG0.pdb.gz	NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana OX=3702 GN=NFYB1 PE=1 SV=2
5	AFDB:Q75IZ7	0.643	0.439	2.205E-8	219	0.252	0.169	Q75IZ7.pdb.gz	NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB8 PE=1 SV=1
6	AFDB:P36611	0.650	0.811	2.353E-8	116	0.252	0.319	P36611.pdb.gz	HAP3_SCHPO Transcriptional activator hap3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hap3 PE=3 SV=1
7	AFDB:Q5QMG3	0.591	0.491	3.050E-8	178	0.252	0.208	Q5QMG3.pdb.gz	NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB2 PE=1 SV=1
8	AFDB:O23310	0.617	0.566	3.953E-8	161	0.259	0.236	O23310.pdb.gz	NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana OX=3702 GN=NFYB3 PE=1 SV=1
9	PDB:5y27A	0.594	0.885	4.178E-8	98	0.238	0.357	5y27A.pdb.gz
10	AFDB:Q5B5Z6	0.625	0.424	4.218E-8	219	0.245	0.164	Q5B5Z6.pdb.gz	Q5B5Z6_EMENI Transcription factor HapC (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04034 PE=1 SV=1
11	AFDB:Q9SFD8	0.646	0.405	5.124E-8	238	0.211	0.130	Q9SFD8.pdb.gz	NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana OX=3702 GN=NFYB9 PE=1 SV=2
12	PDB:2bykD	0.565	0.893	3.551E-7	92	0.299	0.478	2bykD.pdb.gz
13	PDB:1jfiB	0.629	0.683	9.089E-6	135	0.197	0.215	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
14	PDB:6wjv4	0.543	0.727	8.795E-5	107	0.177	0.243	6wjv4.pdb.gz
15	PDB:1b67A	0.412	0.837	2.918E-3	68	0.150	0.324	1b67A.pdb.gz
16	PDB:5y26B	0.475	0.736	3.114E-3	92	0.143	0.228	5y26B.pdb.gz
17	PDB:1bfmA	0.397	0.777	3.545E-3	69	0.143	0.304	1bfmA.pdb.gz
18	PDB:7pj1B	0.468	0.551	3.545E-3	122	0.109	0.131	7pj1B.pdb.gz
19	PDB:6gejG	0.492	0.731	3.782E-3	96	0.116	0.177	6gejG.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:2rvqD	0.458	0.514	4.306E-3	129	0.102	0.116	2rvqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRF9	1.31e-102	291	147	1.000	1.000	DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1
2	Q9JKP7	5.35e-74	219	145	0.782	0.793	DPOE3_MOUSE DNA polymerase epsilon subunit 3 OS=Mus musculus OX=10090 GN=Pole3 PE=1 SV=1
3	Q9V444	3.51e-24	92.4	128	0.347	0.398	DPOE3_DROME DNA polymerase epsilon subunit 3 OS=Drosophila melanogaster OX=7227 GN=Chrac-14 PE=1 SV=1
4	O23310	1.45e-16	73.9	161	0.279	0.255	NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana OX=3702 GN=NFYB3 PE=1 SV=1
5	Q9ZQH2	2.04e-16	75.5	275	0.252	0.135	DPB4_ARATH DNA polymerase II subunit B4 OS=Arabidopsis thaliana OX=3702 GN=NF-YB11 PE=1 SV=1
6	Q9SLG0	8.83e-16	71.2	141	0.286	0.298	NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana OX=3702 GN=NFYB1 PE=1 SV=2
7	P63139	9.93e-16	72.8	207	0.252	0.179	NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus OX=10090 GN=Nfyb PE=1 SV=1
8	P63140	9.93e-16	72.8	207	0.252	0.179	NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus OX=10116 GN=Nfyb PE=1 SV=1
9	P25208	1.00e-15	72.8	207	0.252	0.179	NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens OX=9606 GN=NFYB PE=1 SV=2
10	F8VSL3	1.03e-15	72.8	208	0.252	0.178	F8VSL3_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens OX=9606 GN=NFYB PE=1 SV=2
11	P87174	1.42e-15	72.4	210	0.252	0.176	DPB4_SCHPO DNA polymerase epsilon subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpb4 PE=1 SV=1
12	Q9FGJ3	6.77e-15	70.1	190	0.245	0.189	NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana OX=3702 GN=NFYB2 PE=1 SV=1
13	Q5A0I6	1.49e-14	68.2	149	0.224	0.221	Q5A0I6_CANAL Negative cofactor 2 transcription regulator complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NCB2 PE=4 SV=1
14	F4ITZ0	4.74e-14	67.4	164	0.252	0.226	F4ITZ0_ARATH Nuclear factor Y, subunit B1 OS=Arabidopsis thaliana OX=3702 GN=NF-YB1 PE=1 SV=1
15	Q5QMG3	5.63e-14	67.4	178	0.252	0.208	NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB2 PE=1 SV=1
16	Q75IZ7	6.89e-14	68.2	219	0.238	0.160	NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB8 PE=1 SV=1
17	Q8VYK4	8.15e-14	67.0	173	0.286	0.243	NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana OX=3702 GN=NFYB8 PE=1 SV=1
18	Q67XJ2	1.92e-13	65.9	176	0.265	0.222	NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana OX=3702 GN=NFYB10 PE=1 SV=1
19	Q2UK39	2.21e-13	66.6	215	0.252	0.172	Q2UK39_ASPOR Transcription factor CBF/NF-Y/archaeal histone domain-containing protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000963 PE=3 SV=1
20	Q69J40	2.24e-13	66.6	224	0.231	0.152	NFYBA_ORYSJ Nuclear transcription factor Y subunit B-10 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09073 BUD22	3.6	18.5	BUD22
2	PF00808 CBFD_NFYB_HMF	1.1e-09	49.7	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
3	PF15511 CENP-T_C	1.5	20.3	Centromere kinetochore component CENP-T histone fold
4	PF19268 CIS_TMP	1.4	19.7	Contractile injection system tape measure protein
5	PF02862 DDHD	9.2e+02	11.2	DDHD domain
6	PF15928 DUF4746	2e+02	12.8	Domain of unknown function (DUF4746)
7	PF10310 DUF5427	18	15.8	Family of unknown function (DUF5427)
8	PF00125 Histone	0.052	25.2	Core histone H2A/H2B/H3/H4
9	PF01056 Myc_N	1.6e+02	13.5	Myc amino-terminal region
10	PF03286 Pox_Ag35	4.4e+02	12.1	Pox virus Ag35 surface protein
11	PF11705 RNA_pol_3_Rpc31	3.9e+02	12.4	DNA-directed RNA polymerase III subunit Rpc31
12	PF00588 SpoU_methylase	46	15.6	SpoU rRNA Methylase family
13	PF02969 TAF	1.4e+02	14.0	TATA box binding protein associated factor (TAF)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006061286.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006063200.1	0.999	DNA polymerase epsilon subunit 2 isoform X1
2	89462.XP_006067962.1	0.999	DNA polymerase epsilon subunit 4 isoform X1
3	89462.XP_006078315.1	0.998	DNA polymerase epsilon catalytic subunit A isoform X1
4	89462.XP_006049512.1	0.993	Nucleosome-remodeling factor subunit BPTF
5	89462.XP_006049610.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
6	89462.XP_006061362.1	0.992	Protein Dr1
7	89462.XP_006040643.1	0.991	DNA polymerase epsilon catalytic subunit A-like
8	89462.XP_006042055.1	0.986	Chromatin accessibility complex protein 1
9	89462.XP_006073035.1	0.986	Chromatin accessibility complex protein 1-like
10	89462.XP_006070787.1	0.985	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
11	89462.XP_006048001.1	0.984	Nuclear transcription factor Y subunit gamma isoform X1
12	89462.XP_006080226.1	0.980	DNA polymerase delta catalytic subunit
13	89462.XP_006053652.1	0.979	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
14	89462.XP_006053868.1	0.979	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
15	89462.XP_006065701.1	0.979	Probable global transcription activator SNF2L1 isoform X1
16	89462.XP_006075892.1	0.979	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
17	89462.XP_006061167.1	0.977	Molybdopterin synthase sulfur carrier subunit isoform X1
18	89462.XP_006057217.1	0.976	Tyrosine-protein kinase BAZ1B
19	89462.XP_006043920.1	0.971	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 2 bases in 1 codon
20	89462.XP_006073182.1	0.970	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: deleted 2 bases in 1 codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140640	0.974	catalytic activity, acting on a nucleic acid
GO:0140097	0.964	catalytic activity, acting on DNA
GO:0016740	0.956	transferase activity
GO:0003887	0.805	DNA-directed DNA polymerase activity
GO:0003676	0.626	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0090304	0.984	nucleic acid metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0019219	0.968	regulation of nucleobase-containing compound metabolic process
GO:1901564	0.958	organonitrogen compound metabolic process
GO:0006260	0.948	DNA replication
GO:0006338	0.932	chromatin remodeling
GO:0051052	0.907	regulation of DNA metabolic process
GO:0016570	0.899	histone modification
GO:0071824	0.887	protein-DNA complex subunit organization
GO:0018205	0.887	peptidyl-lysine modification
GO:0018393	0.881	internal peptidyl-lysine acetylation
GO:0065004	0.874	protein-DNA complex assembly
GO:0016573	0.852	histone acetylation
GO:0006275	0.783	regulation of DNA replication
GO:0043966	0.759	histone H3 acetylation
GO:0006261	0.679	DNA-templated DNA replication
GO:0034728	0.656	nucleosome organization
GO:0006334	0.610	nucleosome assembly
GO:0050896	0.412	response to stimulus
GO:0010556	0.389	regulation of macromolecule biosynthetic process
GO:0031326	0.389	regulation of cellular biosynthetic process
GO:0051716	0.327	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0000785	0.998	chromatin
GO:0005654	0.998	nucleoplasm
GO:0140513	0.991	nuclear protein-containing complex
GO:1902494	0.990	catalytic complex
GO:1990234	0.947	transferase complex
GO:0140535	0.943	intracellular protein-containing complex
GO:1902493	0.928	acetyltransferase complex
GO:0000123	0.905	histone acetyltransferase complex
GO:0061695	0.903	transferase complex, transferring phosphorus-containing groups
GO:0140672	0.886	ATAC complex
GO:0042575	0.875	DNA polymerase complex
GO:0000228	0.835	nuclear chromosome
GO:0098687	0.696	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.956	Transferases.
EC:2.7.7.7	0.805	DNA-directed DNA polymerase.

[back to server]