StarFunc result for job id Q9NRG0

User Input

>input (131 residues)
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYS
YRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDN
DNESDHDEADS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRG0	1.000	1.000	4.151E-20	131	1.000	1.000	Q9NRG0.pdb.gz	CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens OX=9606 GN=CHRAC1 PE=1 SV=1
2	AFDB:Q9JKP8	0.790	0.802	2.553E-14	129	0.809	0.822	Q9JKP8.pdb.gz	CHRC1_MOUSE Chromatin accessibility complex protein 1 OS=Mus musculus OX=10090 GN=Chrac1 PE=1 SV=1
3	AFDB:F6NIX9	0.717	0.783	6.708E-11	119	0.511	0.563	F6NIX9.pdb.gz
4	AFDB:Q9V452	0.616	0.579	2.535E-6	140	0.321	0.300	Q9V452.pdb.gz	CHRC_DROME Chromatin accessibility complex 16kD protein OS=Drosophila melanogaster OX=7227 GN=Chrac-16 PE=1 SV=1
5	AFDB:Q9NR33	0.580	0.644	1.438E-5	117	0.229	0.256	Q9NR33.pdb.gz	DPOE4_HUMAN DNA polymerase epsilon subunit 4 OS=Homo sapiens OX=9606 GN=POLE4 PE=1 SV=2
6	AFDB:A0A0R4IHA8	0.444	0.601	1.530E-5	93	0.344	0.484	A0A0R4IHA8.pdb.gz
7	AFDB:Q9LN09	0.629	0.421	1.732E-5	206	0.267	0.170	Q9LN09.pdb.gz	DPB31_ARATH DNA polymerase II subunit B3-1 OS=Arabidopsis thaliana OX=3702 GN=DPB3-1 PE=1 SV=1
8	PDB:5y26B	0.547	0.767	3.091E-5	92	0.221	0.315	5y26B.pdb.gz
9	AFDB:Q6FM95	0.546	0.367	4.390E-5	201	0.252	0.164	Q6FM95.pdb.gz	Q6FM95_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HAP5 PE=4 SV=1
10	AFDB:C8V0B5	0.563	0.291	4.970E-5	265	0.237	0.117	C8V0B5.pdb.gz	C8V0B5_EMENI HapE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06492 PE=1 SV=1
11	AFDB:C6Y4D0	0.567	0.841	7.670E-5	87	0.198	0.299	C6Y4D0.pdb.gz	DPB3_SCHPO DNA polymerase epsilon subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpb3 PE=1 SV=1
12	PDB:6wjv3	0.489	0.716	1.536E-3	85	0.183	0.282	6wjv3.pdb.gz
13	PDB:5y27A	0.493	0.641	2.094E-3	98	0.191	0.255	5y27A.pdb.gz
14	PDB:2bykA	0.415	0.728	6.008E-3	72	0.206	0.375	2bykA.pdb.gz
15	PDB:1jfiB	0.513	0.499	4.648E-2	135	0.099	0.096	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
16	PDB:6wjv4	0.452	0.542	5.956E-2	107	0.107	0.131	6wjv4.pdb.gz
17	PDB:6m4gC	0.428	0.579	9.781E-2	90	0.069	0.100	6m4gC.pdb.gz	Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
18	PDB:1id3C	0.450	0.521	1.419E-1	110	0.076	0.091	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
19	PDB:7edxc	0.413	0.423	1.510E-1	127	0.115	0.118	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:5z30G	0.417	0.477	1.606E-1	110	0.160	0.191	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRG0	7.83e-94	268	131	1.000	1.000	CHRC1_HUMAN Chromatin accessibility complex protein 1 OS=Homo sapiens OX=9606 GN=CHRAC1 PE=1 SV=1
2	Q9JKP8	1.49e-63	191	129	0.725	0.736	CHRC1_MOUSE Chromatin accessibility complex protein 1 OS=Mus musculus OX=10090 GN=Chrac1 PE=1 SV=1
3	Q5EAR4	1.36e-43	140	114	0.511	0.588	Q5EAR4_DANRE Chromatin accessibility complex protein 1 OS=Danio rerio OX=7955 GN=zgc:110753 PE=1 SV=1
4	Q9V452	7.10e-14	65.9	140	0.275	0.257	CHRC_DROME Chromatin accessibility complex 16kD protein OS=Drosophila melanogaster OX=7227 GN=Chrac-16 PE=1 SV=1
5	Q9LN09	2.11e-13	65.9	206	0.252	0.160	DPB31_ARATH DNA polymerase II subunit B3-1 OS=Arabidopsis thaliana OX=3702 GN=DPB3-1 PE=1 SV=1
6	Q6FM95	4.55e-13	65.1	201	0.229	0.149	Q6FM95_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HAP5 PE=4 SV=1
7	O59849	1.27e-12	64.7	265	0.229	0.113	O59849_ASPOZ HAPE OS=Aspergillus oryzae OX=5062 GN=hapE PE=4 SV=1
8	C8V0B5	1.28e-12	64.7	265	0.229	0.113	C8V0B5_EMENI HapE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06492 PE=1 SV=1
9	A6BLW4	1.95e-12	63.9	246	0.244	0.130	NFYC2_ORYSJ Nuclear transcription factor Y subunit C-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC2 PE=1 SV=1
10	Q9FGP7	3.57e-12	62.8	202	0.229	0.149	NFYC6_ARATH Nuclear transcription factor Y subunit C-6 OS=Arabidopsis thaliana OX=3702 GN=NFYC6 PE=2 SV=1
11	Q9SMP0	4.11e-12	62.8	234	0.237	0.132	NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana OX=3702 GN=NFYC1 PE=1 SV=1
12	Q02516	4.12e-12	63.2	242	0.221	0.120	HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP5 PE=1 SV=1
13	Q9ZVL3	6.07e-12	62.4	217	0.252	0.152	NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana OX=3702 GN=NFYC3 PE=1 SV=1
14	Q8L4B2	7.68e-12	62.0	231	0.244	0.139	NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana OX=3702 GN=NFYC9 PE=1 SV=1
15	Q9FMV5	9.87e-12	62.0	250	0.237	0.124	NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana OX=3702 GN=NFYC4 PE=1 SV=1
16	Q8LCG7	1.32e-11	60.8	199	0.221	0.146	NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana OX=3702 GN=NFYC2 PE=1 SV=2
17	Q9XE33	1.32e-11	61.2	205	0.229	0.146	NFYC6_ORYSJ Nuclear transcription factor Y subunit C-6 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC6 PE=1 SV=1
18	A0A1D8PN26	4.34e-11	60.8	348	0.206	0.078	A0A1D8PN26_CANAL Hap5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP5 PE=4 SV=1
19	Q9NR33	4.59e-11	57.8	117	0.221	0.248	DPOE4_HUMAN DNA polymerase epsilon subunit 4 OS=Homo sapiens OX=9606 GN=POLE4 PE=1 SV=2
20	Q9FGP8	6.57e-11	59.3	212	0.244	0.151	NFYC7_ARATH Nuclear transcription factor Y subunit C-7 OS=Arabidopsis thaliana OX=3702 GN=NFYC7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	5.7e-08	44.2	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF00125 Histone	31	16.3	Core histone H2A/H2B/H3/H4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220913

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363286	0.999	DNA polymerase epsilon subunit 3
2	9606.ENSP00000283131	0.996	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
3	9606.ENSP00000353458	0.994	Bromodomain adjacent to zinc finger domain protein 1A
4	9606.ENSP00000216367	0.981	DNA polymerase epsilon subunit 2
5	9606.ENSP00000322570	0.967	DNA polymerase epsilon catalytic subunit A
6	9606.ENSP00000360162	0.958	Probable global transcription activator SNF2L1
7	9606.ENSP00000368349	0.936	DNA polymerase alpha catalytic subunit
8	9606.ENSP00000406046	0.932	DNA polymerase delta catalytic subunit
9	9606.ENSP00000351697	0.929	DNA polymerase zeta catalytic subunit
10	9606.ENSP00000480186	0.927	DNA polymerase delta subunit 2
11	9606.ENSP00000265465	0.926	DNA polymerase alpha subunit B
12	9606.ENSP00000378736	0.923	DNA-directed RNA polymerase III subunit RPC9
13	9606.ENSP00000240055	0.922	Nuclear transcription factor Y subunit beta
14	9606.ENSP00000263681	0.916	DNA polymerase delta subunit 3
15	9606.ENSP00000420176	0.915	DNA polymerase epsilon subunit 4
16	9606.ENSP00000268124	0.906	DNA polymerase subunit gamma-1
17	9606.ENSP00000235310	0.901	Mitotic spindle assembly checkpoint protein MAD2B
18	9606.ENSP00000442563	0.900	DNA polymerase subunit gamma-2, mitochondrial
19	9606.ENSP00000345702	0.890	Nuclear transcription factor Y subunit alpha
20	9606.ENSP00000311513	0.842	Remodeling and spacing factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.845	heterocyclic compound binding
GO:0097159	0.838	organic cyclic compound binding
GO:0003676	0.826	nucleic acid binding
GO:0003677	0.662	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0006338	0.903	chromatin remodeling
GO:0071824	0.889	protein-DNA complex subunit organization
GO:0065004	0.881	protein-DNA complex assembly
GO:0051052	0.845	regulation of DNA metabolic process
GO:0034728	0.806	nucleosome organization
GO:0006334	0.725	nucleosome assembly
GO:0006275	0.663	regulation of DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	0.999	chromatin
GO:0032991	0.973	protein-containing complex
GO:0005634	0.971	nucleus
GO:1902494	0.921	catalytic complex
GO:0140513	0.878	nuclear protein-containing complex
GO:0043233	0.736	organelle lumen
GO:0031981	0.725	nuclear lumen
GO:0070603	0.684	SWI/SNF superfamily-type complex
GO:0098687	0.609	chromosomal region
GO:0000775	0.458	chromosome, centromeric region
GO:0000792	0.354	heterochromatin
GO:0005721	0.325	pericentric heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]