StarFunc result for job id Q9NRG4

User Input

>input (433 residues)
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7M6Z3	0.994	0.994	1.417E-71	433	0.935	0.935	Q7M6Z3.pdb.gz	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
2	PDB:5v3hA	0.977	0.966	1.817E-67	438	0.995	0.984	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
3	AFDB:Q5BJI7	0.994	0.989	1.425E-63	435	0.758	0.754	Q5BJI7.pdb.gz	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1
4	AFDB:Q5RGL7	0.997	0.995	6.300E-60	434	0.649	0.647	Q5RGL7.pdb.gz	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
5	PDB:5ex0A	0.825	0.832	3.614E-36	429	0.305	0.308	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
6	AFDB:E7EZZ6	0.846	0.853	1.108E-35	429	0.319	0.322	E7EZZ6.pdb.gz
7	AFDB:Q2MJQ9	0.825	0.742	2.076E-34	486	0.305	0.272	Q2MJQ9.pdb.gz	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
8	AFDB:Q9CWR2	0.818	0.827	5.891E-34	428	0.312	0.315	Q9CWR2.pdb.gz	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
9	AFDB:P97443	0.848	0.757	6.838E-34	490	0.300	0.265	P97443.pdb.gz	SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus OX=10090 GN=Smyd1 PE=1 SV=3
10	PDB:3n71A	0.830	0.773	1.040E-33	468	0.300	0.278	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
11	AFDB:Q6P0R5	0.852	0.768	3.889E-33	485	0.279	0.249	Q6P0R5.pdb.gz
12	AFDB:Q32LV8	0.716	0.810	9.175E-31	380	0.282	0.321	Q32LV8.pdb.gz	Q32LV8_DANRE Histone-lysine N-methyltransferase SMYD3 OS=Danio rerio OX=7955 GN=zgc:123202 PE=1 SV=1
13	AFDB:Q7XJS0	0.843	0.767	1.636E-29	480	0.242	0.219	Q7XJS0.pdb.gz	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
14	PDB:6ox1B	0.357	0.325	6.654E-9	484	0.171	0.153	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
15	PDB:3qxyA	0.382	0.392	9.254E-8	420	0.150	0.155	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
16	PDB:1ihgA	0.263	0.308	2.838E-3	364	0.065	0.077	1ihgA.pdb.gz
17	PDB:4nrhB	0.252	0.568	4.438E-3	170	0.048	0.124	4nrhB.pdb.gz
18	PDB:7kw7E	0.246	0.316	6.603E-3	327	0.053	0.070	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
19	PDB:5h6zA	0.195	0.628	9.824E-3	123	0.065	0.228	5h6zA.pdb.gz
20	PDB:6n3qF	0.261	0.544	1.032E-2	190	0.044	0.100	6n3qF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5BJI7	0.0	706	435	0.758	0.754	SMY2A_DANRE N-lysine methyltransferase SMYD2-A OS=Danio rerio OX=7955 GN=smyd2a PE=2 SV=1
2	Q5RGL7	0.0	626	434	0.649	0.647	SMY2B_DANRE N-lysine methyltransferase SMYD2-B OS=Danio rerio OX=7955 GN=smyd2b PE=1 SV=2
3	Q7M6Z3	0.0	848	433	0.935	0.935	SMYD2_RAT N-lysine methyltransferase SMYD2 OS=Rattus norvegicus OX=10116 GN=Smyd2 PE=1 SV=1
4	Q8R5A0	0.0	846	433	0.933	0.933	SMYD2_MOUSE N-lysine methyltransferase SMYD2 OS=Mus musculus OX=10090 GN=Smyd2 PE=1 SV=1
5	Q9NRG4	0.0	907	433	1.000	1.000	SMYD2_HUMAN N-lysine methyltransferase SMYD2 OS=Homo sapiens OX=9606 GN=SMYD2 PE=1 SV=2
6	Q2MJQ8	9.70e-74	240	473	0.321	0.294	Q2MJQ8_DANRE Histone methyltransferase SmyD1b OS=Danio rerio OX=7955 GN=symd1 PE=1 SV=1
7	P97443	8.47e-72	236	490	0.314	0.278	SMYD1_MOUSE Histone-lysine N-methyltransferase Smyd1 OS=Mus musculus OX=10090 GN=Smyd1 PE=1 SV=3
8	Q8NB12	2.81e-71	234	490	0.309	0.273	SMYD1_HUMAN Histone-lysine N-methyltransferase SMYD1 OS=Homo sapiens OX=9606 GN=SMYD1 PE=1 SV=1
9	Q9CWR2	7.86e-71	231	428	0.314	0.318	SMYD3_MOUSE Histone-lysine N-methyltransferase SMYD3 OS=Mus musculus OX=10090 GN=Smyd3 PE=2 SV=1
10	Q2MJQ9	3.86e-70	231	486	0.321	0.286	Q2MJQ9_DANRE Histone methyltransferase SmyD1a OS=Danio rerio OX=7955 GN=sth PE=1 SV=1
11	Q9H7B4	5.47e-70	229	428	0.312	0.315	SMYD3_HUMAN Histone-lysine N-methyltransferase SMYD3 OS=Homo sapiens OX=9606 GN=SMYD3 PE=1 SV=4
12	Q32LV8	9.47e-51	177	380	0.212	0.242	Q32LV8_DANRE Histone-lysine N-methyltransferase SMYD3 OS=Danio rerio OX=7955 GN=zgc:123202 PE=1 SV=1
13	Q7XJS0	6.93e-42	156	480	0.261	0.235	ASHR1_ARATH Histone-lysine N-methyltransferase ASHR1 OS=Arabidopsis thaliana OX=3702 GN=ASHR1 PE=1 SV=2
14	O94256	1.20e-23	105	483	0.159	0.143	SET6_SCHPO SET domain and MYND-type zinc finger protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set6 PE=3 SV=1
15	Q8IDE8	5.06e-16	82.4	509	0.141	0.120	Q8IDE8_PLAF7 Histone-lysine N-methyltransferase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1355300 PE=4 SV=1
16	A1Z8L3	8.05e-16	82.0	660	0.178	0.117	A1Z8L3_DROME SET and MYND domain-containing protein 4 OS=Drosophila melanogaster OX=7227 GN=Smyd4-3 PE=4 SV=1
17	Q95RZ8	9.92e-16	81.6	567	0.192	0.146	Q95RZ8_DROME SET and MYND domain-containing protein 4 OS=Drosophila melanogaster OX=7227 GN=Smyd4-3 PE=2 SV=1
18	Q8I4F7	2.11e-14	77.4	507	0.238	0.203	SMYDL_CAEEL Histone-lysine N-methyltransferase set-18 OS=Caenorhabditis elegans OX=6239 GN=set-18 PE=1 SV=1
19	Q23084	7.45e-13	72.8	560	0.226	0.175	Q23084_CAEEL MYND-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=set-30 PE=1 SV=3
20	Q8IYR2	1.51e-12	72.0	804	0.099	0.053	SMYD4_HUMAN SET and MYND domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SMYD4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05347 Complex1_LYR	5.6e+02	12.0	Complex 1 protein (LYR family)
2	PF00856 SET	5.3e-12	57.9	SET domain
3	PF01361 Tautomerase	3.9e+02	12.4	Tautomerase enzyme
4	PF13374 TPR_10	91	14.4	Tetratricopeptide repeat
5	PF13424 TPR_12	4.1	19.1	Tetratricopeptide repeat
6	PF07719 TPR_2	1.6e+02	13.9	Tetratricopeptide repeat
7	PF13181 TPR_8	23	16.5	Tetratricopeptide repeat
8	PF01753 zf-MYND	4e-08	44.5	MYND finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.998	Cellular tumor antigen p53
2	9606.ENSP00000335153	0.977	Heat shock protein HSP 90-alpha
3	9606.ENSP00000378402	0.877	Paired amphipathic helix protein Sin3a
4	9606.ENSP00000367755	0.830	Calmodulin-lysine N-methyltransferase
5	9606.ENSP00000384629	0.786	N-lysine methyltransferase KMT5A
6	9606.ENSP00000327436	0.776	Histone-lysine N-methyltransferase setd3
7	9606.ENSP00000274031	0.761	Histone-lysine N-methyltransferase SETD7
8	9606.ENSP00000362649	0.752	Histone deacetylase 1
9	9606.ENSP00000398516	0.750	Lethal(3)malignant brain tumor-like protein 1
10	9606.ENSP00000351524	0.731	Probable helicase with zinc finger domain
11	9606.ENSP00000386759	0.725	Histone-lysine N-methyltransferase SETD2
12	9606.ENSP00000405330	0.720	Estrogen receptor
13	9606.ENSP00000448035	0.712	Nascent polypeptide-associated complex subunit alpha, muscle-specific form
14	9606.ENSP00000364678	0.699	Histone-lysine N-methyltransferase EHMT2
15	9606.ENSP00000373354	0.699	Histone-lysine N-methyltransferase SETMAR
16	9606.ENSP00000313983	0.693	Histone-lysine N-methyltransferase NSD3
17	9606.ENSP00000381657	0.693	Histone-lysine N-methyltransferase, H3 lysine-79 specific
18	9606.ENSP00000376204	0.690	Histone-lysine N-methyltransferase ASH1L
19	9606.ENSP00000223127	0.670	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
20	9606.ENSP00000369666	0.667	F-box/LRR-repeat protein 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:0002039	0.949	p53 binding
GO:0140938	0.621	histone H3 methyltransferase activity
GO:0019899	0.455	enzyme binding
GO:0046975	0.335	histone H3K36 methyltransferase activity
GO:0003676	0.313	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0043170	0.950	macromolecule metabolic process
GO:0032259	0.925	methylation
GO:0008213	0.905	protein alkylation
GO:0019222	0.894	regulation of metabolic process
GO:0044237	0.893	cellular metabolic process
GO:0080090	0.877	regulation of primary metabolic process
GO:0051171	0.876	regulation of nitrogen compound metabolic process
GO:0031323	0.876	regulation of cellular metabolic process
GO:0060255	0.862	regulation of macromolecule metabolic process
GO:0019219	0.843	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.784	regulation of gene expression
GO:0048523	0.777	negative regulation of cellular process
GO:0009889	0.726	regulation of biosynthetic process
GO:0044260	0.662	cellular macromolecule metabolic process
GO:0010556	0.642	regulation of macromolecule biosynthetic process
GO:0031326	0.636	regulation of cellular biosynthetic process
GO:0018205	0.630	peptidyl-lysine modification
GO:0006479	0.629	protein methylation
GO:0051252	0.598	regulation of RNA metabolic process
GO:0006355	0.525	regulation of DNA-templated transcription
GO:0009892	0.524	negative regulation of metabolic process
GO:0051172	0.503	negative regulation of nitrogen compound metabolic process
GO:0031324	0.500	negative regulation of cellular metabolic process
GO:0048518	0.493	positive regulation of biological process
GO:0010605	0.486	negative regulation of macromolecule metabolic process
GO:0018022	0.479	peptidyl-lysine methylation
GO:0048583	0.469	regulation of response to stimulus
GO:0048522	0.432	positive regulation of cellular process
GO:0032502	0.368	developmental process
GO:0032501	0.366	multicellular organismal process
GO:0048856	0.349	anatomical structure development
GO:0006357	0.334	regulation of transcription by RNA polymerase II
GO:0031327	0.326	negative regulation of cellular biosynthetic process
GO:0051253	0.325	negative regulation of RNA metabolic process
GO:0010558	0.323	negative regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.976	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]