StarFunc result for job id Q9NRG7

User Input

>input (293 residues)
MRVLVGGGTGFIGTALTQLLNARGHEVTLVSRKPGPGRITWDELAASGLPSCDAAVNLAG
ENILNPLRRWNETFQKEVIGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEY
DEDSPGGDFDFFSNLVTKWEAAARLPGDSTRQVVVRSGVVLGRGGGAMGHMLLPFRLGLG
GPIGSGHQFFPWIHIGDLAGILTHALEANHVHGVLNGVAPSSATNAEFAQTLGAALGRRA
FIPLPSAVVQAVFGRQRAIMLLEGQKVIPQRTLATGYQYSFPELGAALKEIVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRG7	1.000	1.000	4.498E-64	293	1.000	1.000	Q9NRG7.pdb.gz	D39U1_HUMAN Epimerase family protein SDR39U1 OS=Homo sapiens OX=9606 GN=SDR39U1 PE=1 SV=3
2	PDB:4b4oA	0.992	0.985	1.051E-60	295	0.983	0.976	4b4oA.pdb.gz	Crystal Structure of Human Epimerase Family Protein Sdr39U1 (Isoform2) with Nadph
3	AFDB:Q9SJU9	0.932	0.791	5.937E-32	347	0.372	0.314	Q9SJU9.pdb.gz	GC1_ARATH Epimerase family protein SDR39U1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GC1 PE=2 SV=2
4	AFDB:P9WGP7	0.918	0.894	6.146E-28	301	0.338	0.329	P9WGP7.pdb.gz	Y2216_MYCTU Epimerase family protein Rv2216 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2216 PE=1 SV=1
5	AFDB:Q9HZ81	0.785	0.734	4.517E-16	316	0.222	0.206	Q9HZ81.pdb.gz	Q9HZ81_PSEAE Probable NAD-dependent epimerase/dehydratase WbpK OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpK PE=4 SV=1
6	AFDB:Q9SZB3	0.804	0.694	2.335E-14	344	0.188	0.160	Q9SZB3.pdb.gz	Q9SZB3_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FLDH PE=1 SV=1
7	AFDB:Q8X7P7	0.747	0.669	3.134E-14	331	0.171	0.151	Q8X7P7.pdb.gz	GNU_ECO57 N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase OS=Escherichia coli O157:H7 OX=83334 GN=gnu PE=1 SV=1
8	AFDB:Q86HU8	0.782	0.643	4.462E-14	363	0.167	0.135	Q86HU8.pdb.gz	Q86HU8_DICDI NAD-dependent epimerase/dehydratase family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276473 PE=4 SV=1
9	PDB:6lttA	0.741	0.702	5.556E-14	311	0.181	0.170	6lttA.pdb.gz
10	AFDB:P9WQP7	0.741	0.602	1.630E-13	370	0.215	0.170	P9WQP7.pdb.gz	3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1106c PE=1 SV=1
11	AFDB:O22809	0.721	0.663	2.461E-13	321	0.208	0.190	O22809.pdb.gz	O22809_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CRL1 PE=1 SV=1
12	AFDB:Q20697	0.732	0.639	2.611E-13	342	0.195	0.167	Q20697.pdb.gz	Q20697_CAEEL NAD(P)-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=bus-5 PE=1 SV=1
13	PDB:2ydxA	0.758	0.717	3.448E-13	312	0.150	0.141	2ydxA.pdb.gz	Insight Into S-Adenosylmethionine Biosynthesis from the Crystal Structures of the Human Methionine Adenosyltransferase Catalytic and Regulatory Subunits.
14	PDB:4lisA	0.711	0.585	4.909E-13	364	0.195	0.157	4lisA.pdb.gz	Elucidation of Substrate Specificity in Aspergillus nidulans UDP-Galactose-4-Epimerase.
15	PDB:1i3kA	0.721	0.618	1.055E-12	347	0.188	0.159	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.
16	PDB:2pk3A	0.751	0.716	1.187E-12	309	0.154	0.146	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
17	PDB:6vo6D	0.762	0.722	2.708E-12	311	0.174	0.164	6vo6D.pdb.gz	Structural Analysis of Cj1427, an Essential NAD-Dependent Dehydrogenase for the Biosynthesis of the Heptose Residues in the Capsular Polysaccharides ofCampylobacter jejuni.
18	PDB:6k0gA	0.758	0.672	3.427E-12	335	0.171	0.149	6k0gA.pdb.gz	Structural basis for broad substrate specificity of UDP-glucose 4-epimerase in the human milk oligosaccharide catabolic pathway of Bifidobacterium longum.
19	PDB:1a9yA	0.736	0.647	4.089E-12	338	0.188	0.163	1a9yA.pdb.gz	Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
20	PDB:4r1sA	0.714	0.661	8.792E-12	319	0.174	0.160	4r1sA.pdb.gz	Structural Studies of Cinnamoyl-CoA Reductase and Cinnamyl-Alcohol Dehydrogenase, Key Enzymes of Monolignol Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRG7	0.0	590	293	1.000	1.000	D39U1_HUMAN Epimerase family protein SDR39U1 OS=Homo sapiens OX=9606 GN=SDR39U1 PE=1 SV=3
2	Q9SJU9	1.95e-54	182	347	0.382	0.323	GC1_ARATH Epimerase family protein SDR39U1 homolog, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GC1 PE=2 SV=2
3	P9WGP7	1.09e-38	139	301	0.345	0.336	Y2216_MYCTU Epimerase family protein Rv2216 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2216 PE=1 SV=1
4	Q9HZ81	0.009	39.7	316	0.229	0.212	Q9HZ81_PSEAE Probable NAD-dependent epimerase/dehydratase WbpK OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=wbpK PE=4 SV=1
5	O74482	0.037	37.4	276	0.068	0.072	YQJ9_SCHPO Uncharacterized protein C1840.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1840.09 PE=3 SV=1
6	Q9SA52	0.041	37.7	378	0.055	0.042	CP41B_ARATH Chloroplast stem-loop binding protein of 41 kDa b, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CSP41B PE=1 SV=1
7	Q8NBZ7	0.049	37.4	420	0.055	0.038	UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens OX=9606 GN=UXS1 PE=1 SV=1
8	Q6GMI9	0.051	37.4	418	0.055	0.038	UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio OX=7955 GN=uxs1 PE=1 SV=2
9	Q91XL3	0.051	37.4	420	0.055	0.038	UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus OX=10090 GN=Uxs1 PE=1 SV=1
10	Q5PQX0	0.054	37.4	420	0.055	0.038	UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus OX=10116 GN=Uxs1 PE=1 SV=1
11	P0A6J5	0.14	35.8	432	0.109	0.074	DADA_ECOLI D-amino acid dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=dadA PE=1 SV=1
12	A2IBG0	0.29	35.0	355	0.058	0.048	A2IBG0_GOSHI Dihydroflavonol 4-reductase OS=Gossypium hirsutum OX=3635 GN=DFR PE=2 SV=1
13	Q0P8I7	0.50	34.3	313	0.058	0.054	GMHD_CAMJE GDP-D-glycero-alpha-D-manno-heptose dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj1427c PE=1 SV=1
14	Q91VT4	0.94	33.1	236	0.065	0.081	CBR4_MOUSE 3-oxoacyl-[acyl-carrier-protein] reductase OS=Mus musculus OX=10090 GN=Cbr4 PE=1 SV=2
15	Q12177	1.0	33.1	298	0.072	0.070	YL056_YEAST Uncharacterized protein YLL056C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLL056C PE=2 SV=1
16	Q9SZB3	1.0	33.1	344	0.048	0.041	Q9SZB3_ARATH NAD(P)-binding Rossmann-fold superfamily protein OS=Arabidopsis thaliana OX=3702 GN=FLDH PE=1 SV=1
17	P9WQP7	1.3	32.7	370	0.058	0.046	3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1106c PE=1 SV=1
18	Q9FVR6	1.5	32.7	296	0.061	0.061	Y1222_ARATH Uncharacterized protein At1g32220, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g32220 PE=1 SV=1
19	C0Z2I3	1.6	32.7	449	0.051	0.033	C0Z2I3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS4 PE=1 SV=1
20	Q3IXP7	1.9	32.3	344	0.061	0.052	Q3IXP7_CERS4 Divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=RSP_3070 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04127 DFP	5e+02	11.9	DNA / pantothenate metabolism flavoprotein
2	PF08338 DUF1731	7.1e-12	56.3	Domain of unknown function (DUF1731)
3	PF01370 Epimerase	0.00011	33.3	NAD dependent epimerase/dehydratase family
4	PF03807 F420_oxidored	3.2e+02	13.4	NADP oxidoreductase coenzyme F420-dependent
5	PF16363 GDP_Man_Dehyd	11	17.0	GDP-mannose 4,6 dehydratase
6	PF03033 Glyco_transf_28	18	16.8	Glycosyltransferase family 28 N-terminal domain
7	PF13439 Glyco_transf_4	3.3e+02	12.7	Glycosyltransferase Family 4
8	PF13579 Glyco_trans_4_4	1.5e+02	14.2	Glycosyl transferase 4-like domain
9	PF08659 KR	6.2e+02	11.7	KR domain
10	PF13460 NAD_binding_10	9.8	17.5	NAD(P)H-binding
11	PF00070 Pyr_redox	16	17.4	Pyridine nucleotide-disulphide oxidoreductase
12	PF04321 RmlD_sub_bind	14	16.2	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382327

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321826	0.762	Syntaxin-binding protein 5
2	9606.ENSP00000315474	0.758	GTPase IMAP family member 7
3	9606.ENSP00000371994	0.758	Protein NYNRIN
4	9606.ENSP00000442478	0.757	Stomatin-like protein 1
5	9606.ENSP00000324302	0.732	Syntaxin-binding protein 6
6	9606.ENSP00000255324	0.677	RING finger protein 17
7	9606.ENSP00000251343	0.665	Protein KHNYN
8	9606.ENSP00000337731	0.652	Cell death activator CIDE-B
9	9606.ENSP00000312126	0.630	Adenylate cyclase type 4
10	9606.ENSP00000309429	0.625	Probable palmitoyltransferase ZDHHC24
11	9606.ENSP00000300850	0.624	Zinc finger protein 646
12	9606.ENSP00000261921	0.619	Lysyl oxidase homolog 1
13	9606.ENSP00000216338	0.608	Granzyme H
14	9606.ENSP00000301671	0.582	GH3 domain-containing protein
15	9606.ENSP00000367823	0.581	Protein FAM214B
16	9606.ENSP00000292363	0.579	E3 ubiquitin-protein ligase RNF126
17	9606.ENSP00000337854	0.567	Hexosaminidase D
18	9606.ENSP00000261407	0.552	Lysophospholipid acyltransferase 5
19	9606.ENSP00000320893	0.536	Ankyrin repeat and SOCS box protein 8
20	9606.ENSP00000216336	0.531	Cathepsin G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	1.000	protein binding
GO:0016491	0.794	oxidoreductase activity
GO:0016740	0.327	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0071704	0.980	organic substance metabolic process
GO:0044238	0.756	primary metabolic process
GO:0044237	0.501	cellular metabolic process
GO:0065007	0.326	biological regulation
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.994	nucleus
GO:0005737	0.873	cytoplasm
GO:0016020	0.671	membrane
GO:0071944	0.346	cell periphery
GO:0005886	0.338	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.794	Oxidoreductases.
EC:2.-.-.-	0.327	Transferases.

[back to server]