StarFunc result for job id Q9NRI5

User Input

>input (854 residues)
MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPA
VGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGI
QLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSA
ELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQ
SPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPG
SSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKL
QEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLE
AKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPP
ETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNH
FWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAY
ETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDER
QMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELGE
KCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA
AASCMTAGVHEAQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRI5	1.000	1.000	0.000	854	1.000	1.000	Q9NRI5.pdb.gz	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
2	AFDB:Q811T9	0.508	0.510	2.386E-64	852	0.566	0.567	Q811T9.pdb.gz	DISC1_MOUSE Disrupted in schizophrenia 1 homolog OS=Mus musculus OX=10090 GN=Disc1 PE=1 SV=2
3	AFDB:Q810H6	0.451	0.455	4.286E-62	846	0.549	0.554	Q810H6.pdb.gz	DISC1_RAT Disrupted in schizophrenia 1 homolog OS=Rattus norvegicus OX=10116 GN=Disc1 PE=1 SV=2
4	AFDB:B8PWL7	0.235	0.203	1.015E-27	994	0.279	0.239	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
5	AFDB:Q8K1N2	0.073	0.053	1.999E-6	1249	0.167	0.114	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
6	AFDB:Q8BI79	0.083	0.062	8.875E-6	1192	0.149	0.107	Q8BI79.pdb.gz	CCD40_MOUSE Coiled-coil domain-containing protein 40 OS=Mus musculus OX=10090 GN=Ccdc40 PE=1 SV=1
7	AFDB:Q4G0X9	0.089	0.069	1.090E-5	1142	0.153	0.115	Q4G0X9.pdb.gz	CCD40_HUMAN Coiled-coil domain-containing protein 40 OS=Homo sapiens OX=9606 GN=CCDC40 PE=1 SV=2
8	AFDB:Q9PTD7	0.090	0.061	1.731E-5	1360	0.160	0.101	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
9	AFDB:Q86SQ0	0.078	0.058	1.822E-5	1253	0.144	0.098	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
10	AFDB:Q96R06	0.084	0.063	1.919E-5	1193	0.156	0.111	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2
11	PDB:5mkkB	0.087	0.121	6.108E-2	577	0.053	0.078	5mkkB.pdb.gz
12	PDB:5nugA	0.115	0.044	4.306E-1	2920	0.028	0.008	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
13	PDB:6z6oC	0.087	0.125	5.289E-1	548	0.036	0.057	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
14	PDB:7myoB	0.137	0.383	5.568E-1	286	0.029	0.087	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
15	PDB:1qoyA	0.102	0.259	6.497E-1	303	0.029	0.083	1qoyA.pdb.gz
16	PDB:5u1dB	0.097	0.135	6.497E-1	552	0.046	0.071	5u1dB.pdb.gz
17	PDB:6xz6A	0.124	0.447	6.497E-1	213	0.021	0.085	6xz6A.pdb.gz
18	PDB:4yknA	0.099	0.076	7.200E-1	1205	0.019	0.013	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
19	PDB:7ph3A	0.091	0.117	9.310E-1	577	0.042	0.062	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
20	PDB:8dcxB	0.110	0.307	9.801E-1	236	0.021	0.076	8dcxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C4P0B1	0.0	1210	622	0.701	0.963	C4P0B1_HUMAN DISC1 scaffold protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=1
2	Q810H6	0.0	779	846	0.554	0.559	DISC1_RAT Disrupted in schizophrenia 1 homolog OS=Rattus norvegicus OX=10116 GN=Disc1 PE=1 SV=2
3	Q811T9	0.0	801	852	0.567	0.568	DISC1_MOUSE Disrupted in schizophrenia 1 homolog OS=Mus musculus OX=10090 GN=Disc1 PE=1 SV=2
4	Q9NRI5	0.0	1730	854	1.000	1.000	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
5	B8PWL7	7.83e-77	271	994	0.232	0.199	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
6	P29616	0.020	41.2	1102	0.055	0.043	MYSC_CHICK Myosin heavy chain, cardiac muscle isoform (Fragment) OS=Gallus gallus OX=9031 PE=1 SV=1
7	O51603	0.12	38.5	521	0.034	0.056	SYK_BORBU Lysine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=lysS PE=1 SV=1
8	P02563	1.0	35.4	1938	0.048	0.021	MYH6_RAT Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=1 SV=2
9	Q8CEZ7	1.1	35.0	372	0.015	0.035	Q8CEZ7_MOUSE Fibrinogen C-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Angptl4 PE=2 SV=1
10	Q6TMA8	1.3	35.0	405	0.015	0.032	ANGL4_RAT Angiopoietin-related protein 4 OS=Rattus norvegicus OX=10116 GN=Angptl4 PE=1 SV=1
11	Q9Z1P8	1.4	34.7	410	0.015	0.032	ANGL4_MOUSE Angiopoietin-related protein 4 OS=Mus musculus OX=10090 GN=Angptl4 PE=1 SV=1
12	P12883	1.7	35.0	1935	0.047	0.021	MYH7_HUMAN Myosin-7 OS=Homo sapiens OX=9606 GN=MYH7 PE=1 SV=5
13	Q8WYA0	2.4	34.3	676	0.054	0.068	IFT81_HUMAN Intraflagellar transport protein 81 homolog OS=Homo sapiens OX=9606 GN=IFT81 PE=1 SV=1
14	Q8L4Q6	3.1	33.9	736	0.035	0.041	Q8L4Q6_ARATH Neurofilament light protein OS=Arabidopsis thaliana OX=3702 GN=At5g25070 PE=1 SV=1
15	P13533	3.2	33.9	1939	0.047	0.021	MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=1 SV=5
16	Q9LEZ4	3.3	33.5	326	0.056	0.147	MBP2C_ARATH Protein MICROTUBULE BINDING PROTEIN 2C OS=Arabidopsis thaliana OX=3702 GN=MBP2C PE=1 SV=1
17	Q586S4	4.0	33.5	1340	0.073	0.046	Q586S4_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.175 PE=4 SV=1
18	P02564	4.3	33.5	1935	0.047	0.021	MYH7_RAT Myosin-7 OS=Rattus norvegicus OX=10116 GN=Myh7 PE=1 SV=2
19	Q91Z83	4.7	33.5	1935	0.047	0.021	MYH7_MOUSE Myosin-7 OS=Mus musculus OX=10090 GN=Myh7 PE=2 SV=1
20	F1LRV9	4.8	33.5	1943	0.055	0.024	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	4.5e+02	12.3	Afadin- and alpha -actinin-Binding
2	PF10473 CENP-F_leu_zip	42	15.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
3	PF18029 Glyoxalase_6	1.1e+02	14.9	Glyoxalase-like domain
4	PF02183 HALZ	1.8e+02	13.7	Homeobox associated leucine zipper
5	PF02151 UVR	2.6e+02	12.8	UvrB/uvrC motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000013751

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000013514	0.957	nudE neurodevelopment protein 1-like 1
2	9593.ENSGGOP00000013954	0.903	nudE neurodevelopment protein 1
3	9593.ENSGGOP00000011540	0.881	Pericentrin
4	9593.ENSGGOP00000001581	0.837	Uncharacterized protein
5	9593.ENSGGOP00000006630	0.832	Phosphodiesterase 4B, cAMP-specific
6	9593.ENSGGOP00000024116	0.827	Phosphodiesterase 4A, cAMP-specific
7	9593.ENSGGOP00000026487	0.826	F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
8	9593.ENSGGOP00000014114	0.779	Uncharacterized protein
9	9593.ENSGGOP00000007378	0.778	TRAF2 and NCK interacting kinase
10	9593.ENSGGOP00000007214	0.768	Glycogen synthase kinase 3 beta
11	9593.ENSGGOP00000005079	0.762	Fasciculation and elongation protein zeta 1 (zygin I)
12	9593.ENSGGOP00000012095	0.759	Coiled-coil domain containing 88A
13	9593.ENSGGOP00000017880	0.746	TNF receptor-associated factor 3 interacting protein 1
14	9593.ENSGGOP00000005434	0.741	Dystrobrevin binding protein 1
15	9593.ENSGGOP00000016993	0.733	Serine racemase
16	9593.ENSGGOP00000018859	0.730	Zinc finger protein 365
17	9593.ENSGGOP00000024528	0.730	Dopamine receptor D2
18	9593.ENSGGOP00000005198	0.729	Platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa)
19	9593.ENSGGOP00000026394	0.729	Uncharacterized protein
20	9593.ENSGGOP00000006828	0.719	Phosphodiesterase 4D, cAMP-specific

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0016043	0.990	cellular component organization
GO:0007275	0.988	multicellular organism development
GO:0048522	0.982	positive regulation of cellular process
GO:0030030	0.980	cell projection organization
GO:0060284	0.978	regulation of cell development
GO:0051960	0.978	regulation of nervous system development
GO:0030154	0.977	cell differentiation
GO:0007399	0.976	nervous system development
GO:0023051	0.972	regulation of signaling
GO:0010646	0.972	regulation of cell communication
GO:0050767	0.970	regulation of neurogenesis
GO:0120036	0.967	plasma membrane bounded cell projection organization
GO:0051240	0.960	positive regulation of multicellular organismal process
GO:0048699	0.953	generation of neurons
GO:0009967	0.953	positive regulation of signal transduction
GO:0050769	0.950	positive regulation of neurogenesis
GO:0001764	0.941	neuron migration
GO:0060271	0.938	cilium assembly
GO:0050896	0.920	response to stimulus
GO:0007017	0.881	microtubule-based process
GO:0042127	0.861	regulation of cell population proliferation
GO:0051179	0.859	localization
GO:0007010	0.854	cytoskeleton organization
GO:0048513	0.840	animal organ development
GO:0008284	0.810	positive regulation of cell population proliferation
GO:2000177	0.798	regulation of neural precursor cell proliferation
GO:0051716	0.732	cellular response to stimulus
GO:0007417	0.676	central nervous system development
GO:0007154	0.672	cell communication
GO:0060322	0.644	head development
GO:0023052	0.633	signaling
GO:0007420	0.617	brain development
GO:0065008	0.613	regulation of biological quality
GO:0030900	0.613	forebrain development
GO:0021537	0.602	telencephalon development
GO:0007165	0.511	signal transduction
GO:0021543	0.489	pallium development
GO:0051641	0.483	cellular localization
GO:0051128	0.483	regulation of cellular component organization
GO:0021987	0.461	cerebral cortex development
GO:0019222	0.445	regulation of metabolic process
GO:0048468	0.444	cell development
GO:0030111	0.419	regulation of Wnt signaling pathway
GO:0071704	0.413	organic substance metabolic process
GO:0000226	0.413	microtubule cytoskeleton organization
GO:1905515	0.410	non-motile cilium assembly
GO:0065009	0.409	regulation of molecular function
GO:0030182	0.397	neuron differentiation
GO:0048519	0.396	negative regulation of biological process
GO:0002052	0.376	positive regulation of neuroblast proliferation
GO:0031323	0.375	regulation of cellular metabolic process
GO:0080090	0.372	regulation of primary metabolic process
GO:0051171	0.372	regulation of nitrogen compound metabolic process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0009653	0.365	anatomical structure morphogenesis
GO:0030177	0.365	positive regulation of Wnt signaling pathway
GO:0044237	0.357	cellular metabolic process
GO:0022029	0.355	telencephalon cell migration
GO:0048523	0.345	negative regulation of cellular process
GO:0031344	0.335	regulation of cell projection organization
GO:0021799	0.335	cerebral cortex radially oriented cell migration
GO:0120035	0.332	regulation of plasma membrane bounded cell projection organization
GO:0010975	0.318	regulation of neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042995	0.998	cell projection
GO:0005829	0.997	cytosol
GO:0015630	0.995	microtubule cytoskeleton
GO:0043227	0.992	membrane-bounded organelle
GO:0120025	0.988	plasma membrane bounded cell projection
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005813	0.975	centrosome
GO:0045202	0.962	synapse
GO:0098794	0.935	postsynapse
GO:0098793	0.913	presynapse
GO:0032991	0.906	protein-containing complex
GO:0071944	0.864	cell periphery
GO:0016020	0.810	membrane
GO:0005739	0.803	mitochondrion
GO:0005929	0.772	cilium
GO:0098978	0.715	glutamatergic synapse
GO:0014069	0.659	postsynaptic density
GO:0043005	0.557	neuron projection
GO:0012505	0.428	endomembrane system
GO:0045111	0.417	intermediate filament cytoskeleton
GO:0031981	0.417	nuclear lumen
GO:0005886	0.414	plasma membrane
GO:0005654	0.387	nucleoplasm
GO:0098982	0.308	GABA-ergic synapse
GO:0097546	0.301	ciliary base

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]