StarFunc result for job id Q9NRJ4

User Input

>input (1543 residues)
MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFT
SSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVEL
VNDRGAQVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQ
QVLFGTADGQVIVMDCHGRMLAHVLLHESDGVLGMSWNYPIFLVEDSSESDTDSDDYAPP
QDGPAAYPIPVQNIKPLLTVSFTSGDISLMNNYDDLSPTVIRSGLKEVVAQWCTQGDLLA
VAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICWGHRDSRLLMA
SGPALYVVRVEHRVSSLQLLCQQAIASTLREDKDVSKLTLPPRLCSYLSTAFIPTIKPPI
PDPNNMRDFVSYPSAGNERLHCTMKRTEDDPEVGGPCYTLYLEYLGGLVPILKGRRISKL
RPEFVIMDPRTDSKPDEIYGNSLISTVIDSCNCSDSSDIELSDDWAAKKSPKISRASKSP
KLPRISIEARKSPKLPRAAQELSRSPRLPLRKPSVGSPSLTRREFPFEDITQHNYLAQVT
SNIWGTKFKIVGLAAFLPTNLGAVIYKTSLLHLQPRQMTIYLPEVRKISMDYINLPVFNP
NVFSEDEDDLPVTGASGVPENSPPCTVNIPIAPIHSSAQAMSPTQSIGLVQSLLANQNVQ
LDVLTNQTTAVGTAEHAGDSATQYPVSNRYSNPGQVIFGSVEMGRIIQNPPPLSLPPPPQ
GPMQLSTVGHGDRDHEHLQKSAKALRPTPQLAAEGDAVVFSAPQEVQVTKINPPPPYPGT
IPAAPTTAAPPPPLPPPQPPVDVCLKKGDFSLYPTSVHYQTPLGYERITTFDSSGNVEEV
CRPRTRMLCSQNTYTLPGPGSSATLRLTATEKKVPQPCSSATLNRLTVPRYSIPTGDPPP
YPEIASQLAQGRGAAQRSDNSLIHATLRRNNREATLKMAQLADSPRAPLQPLAKSKGGPG
GVVTQLPARPPPALYTCSQCSGTGPSSQPGASLAHTASASPLASQSSYSLLSPPDSARDR
TDYVNSAFTEDEALSQHCQLEKPLRHPPLPEAAVTLKRPPPYQWDPMLGEDVWVPQERTA
QTSGPNPLKLSSLMLSQGQHLDVSRLPFISPKSPASPTATFQTGYGMGVPYPGSYNNPPL
PGVQAPCSPKDALSPTQFAQQEPAVVLQPLYPPSLSYCTLPPMYPGSSTCSSLQLPPVAL
HPWSSYSACPPMQNPQGTLPPKPHLVVEKPLVSPPPADLQSHLGTEVMVETADNFQEVLS
LTESPVPQRTEKFGKKNRKRLDSRAEEGSVQAITEGKVKKEARTLSDFNSLISSPHLGRE
KKKVKSQKDQLKSKKLNKTNEFQDSSESEPELFISGDELMNQSQGSRKGWKSKRSPRAAG
ELEEAKCRRASEKEDGRLGSQGFVYVMANKQPLWNEATQVYQLDFGGRVTQESAKNFQIE
LEGRQVMQFGRIDGSAYILDFQYPFSAVQAFAVALANVTQRLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRJ4	1.000	1.000	0.000	1543	1.000	1.000	Q9NRJ4.pdb.gz	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2
2	AFDB:A0A0B4KI44	0.404	0.434	7.282E-94	1433	0.324	0.349	A0A0B4KI44.pdb.gz	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
3	PDB:7bt6x	0.166	0.474	7.178E-14	488	0.041	0.129	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
4	AFDB:M9PB01	0.100	0.071	2.127E-13	2397	0.141	0.091	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
5	PDB:5mzhB	0.157	0.528	5.158E-13	415	0.028	0.104	5mzhB.pdb.gz
6	PDB:7apkC	0.172	0.812	1.702E-12	304	0.032	0.161	7apkC.pdb.gz
7	PDB:5nnzA	0.161	0.636	1.792E-12	335	0.032	0.149	5nnzA.pdb.gz
8	PDB:5yzgs	0.170	0.653	1.792E-12	374	0.037	0.152	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
9	PDB:3jcmB	0.173	0.583	1.888E-12	429	0.032	0.114	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
10	PDB:3zwlD	0.176	0.692	2.094E-12	352	0.032	0.139	3zwlD.pdb.gz
11	PDB:5jcsq	0.167	0.470	2.715E-12	488	0.041	0.131	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
12	AFDB:Q9C0J8	0.173	0.198	4.787E-12	1336	0.135	0.156	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
13	PDB:7zgrD	0.169	0.612	5.914E-12	395	0.030	0.116	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
14	PDB:7mq8LU	0.171	0.542	6.910E-12	445	0.029	0.099	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	AFDB:Q6NS57	0.181	0.185	2.156E-11	1503	0.128	0.131	Q6NS57.pdb.gz	MABP1_MOUSE Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1
16	AFDB:F1LRR4	0.169	0.168	2.795E-11	1551	0.113	0.112	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
17	AFDB:Q389F7	0.153	0.210	1.072E-7	1105	0.109	0.152	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
18	AFDB:Q9VC96	0.156	0.113	2.728E-7	2232	0.129	0.089	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
19	AFDB:Q9W1X4	0.143	0.132	2.413E-6	1711	0.137	0.124	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
20	AFDB:A8WIP5	0.119	0.096	6.469E-6	1993	0.156	0.120	A8WIP5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRJ4	0.0	3169	1543	1.000	1.000	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2
2	A0A0B4KI44	8.99e-167	543	1433	0.203	0.218	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
3	B7ZD88	2.12e-35	149	1203	0.067	0.086	B7ZD88_DANRE WD repeat-containing protein 35 OS=Danio rerio OX=7955 GN=im:7159945 PE=1 SV=1
4	Q9P2L0	6.03e-34	145	1181	0.067	0.088	WDR35_HUMAN WD repeat-containing protein 35 OS=Homo sapiens OX=9606 GN=WDR35 PE=1 SV=3
5	Q8BND3	2.36e-33	143	1181	0.067	0.088	WDR35_MOUSE WD repeat-containing protein 35 OS=Mus musculus OX=10090 GN=Wdr35 PE=1 SV=3
6	A6N6J5	3.09e-33	142	1170	0.067	0.089	WDR35_RAT WD repeat-containing protein 35 OS=Rattus norvegicus OX=10116 GN=Wdr35 PE=1 SV=1
7	Q57ZX9	2.18e-30	133	1260	0.058	0.071	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
8	Q9W097	4.76e-30	132	1205	0.065	0.084	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
9	Q18859	1.77e-24	114	1246	0.067	0.083	Q18859_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifta-1 PE=4 SV=4
10	Q09306	5.04e-17	87.8	426	0.028	0.101	TUB1_CAEEL Tubby protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=tub-1 PE=1 SV=3
11	P50586	2.06e-15	83.6	505	0.025	0.077	TUB_MOUSE Tubby protein OS=Mus musculus OX=10090 GN=Tub PE=1 SV=1
12	O88808	2.08e-15	83.6	505	0.025	0.077	TUB_RAT Tubby protein homolog OS=Rattus norvegicus OX=10116 GN=Tub PE=2 SV=1
13	P50607	2.28e-15	83.2	506	0.025	0.077	TUB_HUMAN Tubby protein homolog OS=Homo sapiens OX=9606 GN=TUB PE=1 SV=1
14	O88413	3.67e-15	82.4	460	0.025	0.085	TULP3_MOUSE Tubby-related protein 3 OS=Mus musculus OX=10090 GN=Tulp3 PE=1 SV=1
15	O75386	1.63e-14	80.1	442	0.025	0.086	TULP3_HUMAN Tubby-related protein 3 OS=Homo sapiens OX=9606 GN=TULP3 PE=1 SV=2
16	Q86PC9	5.00e-14	79.0	460	0.023	0.078	TULP_DROME Protein king tubby OS=Drosophila melanogaster OX=7227 GN=ktub PE=1 SV=1
17	Q9Z273	6.70e-14	79.0	543	0.025	0.070	TULP1_MOUSE Tubby-related protein 1 OS=Mus musculus OX=10090 GN=Tulp1 PE=1 SV=1
18	O00294	1.10e-13	78.2	542	0.024	0.068	TULP1_HUMAN Tubby-related protein 1 OS=Homo sapiens OX=9606 GN=TULP1 PE=1 SV=3
19	Q0WPY0	3.44e-12	72.8	413	0.023	0.087	TLP6_ARATH Tubby-like F-box protein 6 OS=Arabidopsis thaliana OX=3702 GN=TULP6 PE=2 SV=1
20	Q8GVE5	3.87e-12	72.4	394	0.021	0.084	TLP2_ARATH Tubby-like F-box protein 2 OS=Arabidopsis thaliana OX=3702 GN=TULP2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0024	29.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF07525 SOCS_box	0.67	21.7	SOCS box
3	PF01167 Tub	2.2e-25	101.4	Tub family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376808	0.755	Cullin-5
2	9606.ENSP00000215582	0.740	Mitotic interactor and substrate of PLK1
3	9606.ENSP00000262231	0.734	Regulating synaptic membrane exocytosis protein 2
4	9606.ENSP00000281830	0.707	Potassium voltage-gated channel subfamily E member 4
5	9606.ENSP00000262306	0.695	Elongin-B
6	9606.ENSP00000359264	0.694	Breast cancer anti-estrogen resistance protein 3
7	9606.ENSP00000356057	0.685	Transmembrane protein 181
8	9606.ENSP00000350049	0.674	Homeobox and leucine zipper protein Homez
9	9606.ENSP00000381333	0.637	Corticotropin-releasing factor receptor 1
10	9606.ENSP00000478121	0.606	Elongin-C
11	9606.ENSP00000250495	0.600	NEDD8
12	9606.ENSP00000263401	0.600	COMM domain-containing protein 9
13	9606.ENSP00000267935	0.600	COMM domain-containing protein 4
14	9606.ENSP00000273480	0.600	RING-box protein 2
15	9606.ENSP00000274458	0.600	COMM domain-containing protein 10
16	9606.ENSP00000278980	0.600	COMM domain-containing protein 7
17	9606.ENSP00000308236	0.600	COMM domain-containing protein 1
18	9606.ENSP00000348054	0.600	COMM domain containing 6
19	9606.ENSP00000365401	0.600	Coiled-coil domain-containing protein 22
20	9606.ENSP00000366032	0.600	COMM domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.867	biological regulation
GO:0050789	0.842	regulation of biological process
GO:0050794	0.806	regulation of cellular process
GO:0071840	0.708	cellular component organization or biogenesis
GO:0016043	0.703	cellular component organization
GO:0008152	0.493	metabolic process
GO:0044238	0.451	primary metabolic process
GO:0071704	0.449	organic substance metabolic process
GO:0044085	0.349	cellular component biogenesis
GO:0006807	0.344	nitrogen compound metabolic process
GO:0007154	0.337	cell communication
GO:0044237	0.315	cellular metabolic process
GO:0022607	0.310	cellular component assembly
GO:0050896	0.307	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.890	organelle
GO:0043229	0.844	intracellular organelle
GO:0043227	0.710	membrane-bounded organelle
GO:0016020	0.680	membrane
GO:0043231	0.419	intracellular membrane-bounded organelle
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]