StarFunc result for job id Q9NRK6

User Input

>input (738 residues)
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLW
GVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPG
GPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTM
SSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSG
QRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
SVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGN
VRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEG
VILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLL
LRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTA
EEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEA
TSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLS
KPNGIYRKLMNKQSFISA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRK6	1.000	1.000	0.000	738	1.000	1.000	Q9NRK6.pdb.gz	ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB10 PE=1 SV=2
2	AFDB:Q9JI39	0.807	0.832	7.773E-84	715	0.730	0.754	Q9JI39.pdb.gz	ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus OX=10090 GN=Abcb10 PE=1 SV=1
3	AFDB:F1Q5K6	0.778	0.808	5.222E-71	710	0.580	0.603	F1Q5K6.pdb.gz	F1Q5K6_DANRE ATP-binding cassette sub-family B member 10, mitochondrial OS=Danio rerio OX=7955 GN=abcb10 PE=1 SV=1
4	AFDB:Q0WML0	0.764	0.872	5.921E-50	644	0.356	0.408	Q0WML0.pdb.gz	AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana OX=3702 GN=ABCB27 PE=1 SV=1
5	AFDB:Q9NUT2	0.770	0.773	2.761E-49	735	0.340	0.341	Q9NUT2.pdb.gz	MITOS_HUMAN Mitochondrial potassium channel ATP-binding subunit OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=3
6	AFDB:Q9CXJ4	0.766	0.788	1.414E-48	717	0.333	0.343	Q9CXJ4.pdb.gz	MITOS_MOUSE Mitochondrial potassium channel ATP-binding subunit OS=Mus musculus OX=10090 GN=Abcb8 PE=1 SV=1
7	AFDB:Q9GTN7	0.732	0.318	5.720E-45	1752	0.285	0.120	Q9GTN7.pdb.gz	TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum OX=44689 GN=tagA PE=1 SV=2
8	AFDB:Q6P2Q0	0.738	0.710	1.924E-44	769	0.310	0.298	Q6P2Q0.pdb.gz	Q6P2Q0_HUMAN ABCB9 protein OS=Homo sapiens OX=9606 GN=ABCB9 PE=2 SV=1
9	AFDB:Q9TZD9	0.730	0.686	8.175E-44	787	0.285	0.267	Q9TZD9.pdb.gz	Q9TZD9_CAEEL ABC-type antigen peptide transporter OS=Caenorhabditis elegans OX=6239 GN=haf-4 PE=1 SV=2
10	AFDB:Q1LWX8	0.730	0.742	8.565E-44	725	0.280	0.286	Q1LWX8.pdb.gz
11	PDB:3qf4B	0.725	0.901	2.365E-38	588	0.271	0.340	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
12	PDB:7ehlA	0.639	0.821	3.771E-38	563	0.314	0.412	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
13	PDB:4m1mA	0.682	0.433	3.951E-38	1188	0.282	0.175	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
14	PDB:5mkkB	0.702	0.885	1.931E-37	577	0.229	0.293	5mkkB.pdb.gz
15	PDB:5mkkA	0.702	0.861	2.221E-37	593	0.252	0.314	5mkkA.pdb.gz
16	PDB:7ph3A	0.639	0.795	2.438E-37	577	0.263	0.336	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
17	PDB:4f4cA	0.611	0.377	6.903E-35	1250	0.262	0.154	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
18	PDB:7niwA	0.685	0.454	1.390E-34	1140	0.282	0.182	7niwA.pdb.gz	Structures of ABCB4 provide insight into phosphatidylcholine translocation.
19	PDB:4q4aA	0.691	0.877	2.216E-34	572	0.225	0.290	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
20	PDB:6qexA	0.685	0.438	3.219E-34	1182	0.283	0.177	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q5K6	0.0	845	710	0.565	0.587	F1Q5K6_DANRE ATP-binding cassette sub-family B member 10, mitochondrial OS=Danio rerio OX=7955 GN=abcb10 PE=1 SV=1
2	Q9JI39	0.0	1048	715	0.709	0.731	ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus OX=10090 GN=Abcb10 PE=1 SV=1
3	Q9NRK6	0.0	1480	738	1.000	1.000	ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB10 PE=1 SV=2
4	Q54BU4	1.10e-159	487	909	0.337	0.274	ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum OX=44689 GN=abcB1 PE=3 SV=1
5	Q9FNU2	3.51e-154	464	641	0.344	0.396	AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCB25 PE=2 SV=1
6	Q9Y7M7	8.72e-149	453	726	0.341	0.347	MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdl1 PE=3 SV=1
7	P33310	4.69e-148	450	695	0.347	0.368	MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDL1 PE=1 SV=2
8	Q9CXJ4	4.27e-146	446	717	0.324	0.333	MITOS_MOUSE Mitochondrial potassium channel ATP-binding subunit OS=Mus musculus OX=10090 GN=Abcb8 PE=1 SV=1
9	Q0WML0	1.94e-144	439	644	0.351	0.402	AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana OX=3702 GN=ABCB27 PE=1 SV=1
10	O45278	6.52e-142	434	677	0.317	0.346	O45278_CAEEL HAlF transporter (PGP related) OS=Caenorhabditis elegans OX=6239 GN=haf-1 PE=4 SV=2
11	Q54W24	4.93e-140	432	767	0.305	0.293	ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcB4 PE=3 SV=1
12	Q9NUT2	3.88e-139	428	735	0.309	0.310	MITOS_HUMAN Mitochondrial potassium channel ATP-binding subunit OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=3
13	Q9BL17	6.72e-139	426	668	0.312	0.344	Q9BL17_CAEEL ATP-binding cassette sub-family B member 8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=haf-6 PE=1 SV=3
14	P33311	2.72e-138	427	773	0.332	0.317	MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDL2 PE=1 SV=3
15	Q9NP78	1.99e-132	412	766	0.317	0.305	ABCB9_HUMAN ABC-type oligopeptide transporter ABCB9 OS=Homo sapiens OX=9606 GN=ABCB9 PE=1 SV=1
16	Q6P2Q0	2.01e-130	407	769	0.317	0.304	Q6P2Q0_HUMAN ABCB9 protein OS=Homo sapiens OX=9606 GN=ABCB9 PE=2 SV=1
17	Q9QYJ4	7.73e-130	405	762	0.313	0.303	ABCB9_RAT ABC-type oligopeptide transporter ABCB9 OS=Rattus norvegicus OX=10116 GN=Abcb9 PE=1 SV=1
18	Q9TZD9	1.09e-122	387	787	0.289	0.271	Q9TZD9_CAEEL ABC-type antigen peptide transporter OS=Caenorhabditis elegans OX=6239 GN=haf-4 PE=1 SV=2
19	O02086	5.36e-118	374	773	0.251	0.239	O02086_CAEEL ABC-type antigen peptide transporter OS=Caenorhabditis elegans OX=6239 GN=haf-2 PE=1 SV=2
20	Q9M1Q9	1.57e-117	385	1296	0.310	0.177	AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana OX=3702 GN=ABCB21 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	22	16.9	ATPase family associated with various cellular activities (AAA)
2	PF13175 AAA_15	2.2e+02	12.7	AAA ATPase domain
3	PF13191 AAA_16	4.6	19.1	AAA ATPase domain
4	PF13304 AAA_21	1.4	20.2	AAA domain, putative AbiEii toxin, Type IV TA system
5	PF13401 AAA_22	5.5	18.7	AAA domain
6	PF13476 AAA_23	1.9e+02	14.0	AAA domain
7	PF13481 AAA_25	93	14.0	AAA domain
8	PF13555 AAA_29	1.2	20.3	P-loop containing region of AAA domain
9	PF13604 AAA_30	12	17.1	AAA domain
10	PF13671 AAA_33	5e+02	12.3	AAA domain
11	PF07728 AAA_5	3.5e+02	12.6	AAA domain (dynein-related subfamily)
12	PF09818 ABC_ATPase	0.066	23.8	ATPase of the ABC class
13	PF00664 ABC_membrane	8.1e-56	201.3	ABC transporter transmembrane region
14	PF00005 ABC_tran	1.9e-31	120.9	ABC transporter
15	PF03193 RsgA_GTPase	1.2e+02	14.0	RsgA GTPase
16	PF02463 SMC_N	3.9e-05	34.8	RecF/RecN/SMC N terminal domain
17	PF06414 Zeta_toxin	6	17.7	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429200	0.988	Mitoferrin-1
2	9606.ENSP00000372326	0.984	Ferrochelatase, mitochondrial
3	9606.ENSP00000359526	0.925	Mitoferrin-2
4	9606.ENSP00000379568	0.797	Acyl-CoA-binding domain-containing protein 5
5	9606.ENSP00000273158	0.779	Solute carrier family 25 member 38
6	9606.ENSP00000253577	0.747	ATP-binding cassette sub-family B member 7, mitochondrial
7	9606.ENSP00000332369	0.747	5-aminolevulinate synthase, erythroid-specific, mitochondrial
8	9606.ENSP00000417085	0.708	Solute carrier family 15 member 2
9	9606.ENSP00000356978	0.702	Protoporphyrinogen oxidase
10	9606.ENSP00000297504	0.667	ATP-binding cassette sub-family B member 8, mitochondrial
11	9606.ENSP00000371689	0.664	Cadherin-12
12	9606.ENSP00000365686	0.659	Solute carrier family 15 member 1
13	9606.ENSP00000370936	0.651	Transcription factor E2F6
14	9606.ENSP00000355938	0.635	Feline leukemia virus subgroup C receptor-related protein 1
15	9606.ENSP00000264193	0.632	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
16	9606.ENSP00000296577	0.631	ATP-binding cassette sub-family E member 1
17	9606.ENSP00000376822	0.625	Metalloreductase STEAP3
18	9606.ENSP00000276062	0.617	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
19	9606.ENSP00000444561	0.613	Transmembrane protein 14C
20	9606.ENSP00000386284	0.611	Delta-aminolevulinic acid dehydratase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0022857	0.988	transmembrane transporter activity
GO:0042803	0.988	protein homodimerization activity
GO:0016887	0.986	ATP hydrolysis activity
GO:0043167	0.755	ion binding
GO:0005524	0.740	ATP binding
GO:0022804	0.703	active transmembrane transporter activity
GO:0042626	0.685	ATPase-coupled transmembrane transporter activity
GO:0140359	0.318	ABC-type transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.828	regulation of biological process
GO:0050896	0.780	response to stimulus
GO:0042592	0.687	homeostatic process
GO:0032501	0.655	multicellular organismal process
GO:0032502	0.602	developmental process
GO:0048856	0.587	anatomical structure development
GO:0050794	0.568	regulation of cellular process
GO:0030099	0.531	myeloid cell differentiation
GO:0048872	0.507	homeostasis of number of cells
GO:0006810	0.483	transport
GO:0008152	0.471	metabolic process
GO:0002376	0.377	immune system process
GO:0071704	0.365	organic substance metabolic process
GO:0044237	0.323	cellular metabolic process
GO:0042221	0.308	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005739	0.999	mitochondrion
GO:0031090	0.963	organelle membrane
GO:0070013	0.917	intracellular organelle lumen
GO:0005740	0.901	mitochondrial envelope
GO:0031981	0.429	nuclear lumen
GO:0005654	0.415	nucleoplasm
GO:0005886	0.402	plasma membrane
GO:0031966	0.401	mitochondrial membrane
GO:0032991	0.352	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.986	ATP + H2O = ADP + H(+) + phosphate
EC:7.-.-.-	0.685	Translocases.

[back to server]