StarFunc result for job id Q9NRL2

User Input

>input (1556 residues)
MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRP
GLTYQEALESEKKARQNLQSFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEE
TVEVIRNNGARLQCRILEVLPPSHQNGFANGHVNSVDGETIIISDSDDSETQSCSFQNGK
KKDAIDPLLFKYKVQPTKKELHESAIVKATQISRRKHLFSRDKLKLFLKQHCEPQDGVIK
IKASSLSTYKIAEQDFSYFFPDDPPTFIFSPANRRRGRPPKRIHISQEDNVANKQTLASY
RSKATKERDKLLKQEEMKSLAFEKAKLKREKADALEAKKKEKEDKEKKREELKKIVEEER
LKKKEEKERLKVEREKEREKLREEKRKYVEYLKQWSKPREDMECDDLKELPEPTPVKTRL
PPEIFGDALMVLEFLNAFGELFDLQDEFPDGVTLEVLEEALVGNDSEGPLCELLFFFLTA
IFQAIAEEEEEVAKEQLTDADTKDLTEALDEDADPTKSALSAVASLAAAWPQLHQGCSLK
SLDLDSCTLSEILRLHILASGADVTSANAKYRYQKRGGFDATDDACMELRLSNPSLVKKL
SSTSVYDLTPGEKMKILHALCGKLLTLVSTRDFIEDYVDILRQAKQEFRELKAEQHRKER
EEAAARIRKRKEEKLKEQEQKMKEKQEKLKEDEQRNSTADISIGEEEREDFDTSIESKDT
EQKELDQDMVTEDEDDPGSHKRGRRGKRGQNGFKEFTRQEQINCVTREPLTADEEEALKQ
EHQRKEKELLEKIQSAIACTNIFPLGRDRMYRRYWIFPSIPGLFIEEDYSGLTEDMLLPR
PSSFQNNVQSQDPQVSTKTGEPLMSESTSNIDQGPRDHSVQLPKPVHKPNRWCFYSSCEQ
LDQLIEALNSRGHRESALKETLLQEKSRICAQLARFSEEKFHFSDKPQPDSKPTYSRGRS
SNAYDPSQMCAEKQLELRLRDFLLDIEDRIYQGTLGAIKVTDRHIWRSALESGRYELLSE
ENKENGIIKTVNEDVEEMEIDEQTKVIVKDRLLGIKTETPSTVSTNASTPQSVSSVVHYL
AMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESLLSSASLSQVFLHLSTLDRSV
IWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRPKQR
SRRLSSRQRPSLESDEDVEDSMGGEDDEVDGDEEEGQSEEEEYEVEQDEDDSQEEEEVSL
PKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVSSKTGRSLRKINS
APPTETKSLRIASRSTRHSHGPLQADVFVELLSPRRKRRGRKSANNTPENSPNFPNFRVI
ATKSSEQSRSVNIASKLSLQESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQ
LVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIEL
MFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88379	0.556	0.556	0.000	1555	0.872	0.873	O88379.pdb.gz	BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus OX=10090 GN=Baz1a PE=1 SV=3
2	AFDB:Q9NRL2	1.000	1.000	0.000	1556	1.000	1.000	Q9NRL2.pdb.gz	BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2
3	AFDB:A0A0R4IUG1	0.066	0.039	3.045E-5	2679	0.085	0.050	A0A0R4IUG1.pdb.gz
4	AFDB:Q9NPI1	0.061	0.141	1.090E-4	651	0.036	0.086	Q9NPI1.pdb.gz	BRD7_HUMAN Bromodomain-containing protein 7 OS=Homo sapiens OX=9606 GN=BRD7 PE=1 SV=1
5	AFDB:O88665	0.062	0.141	2.589E-4	651	0.037	0.088	O88665.pdb.gz	BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus OX=10090 GN=Brd7 PE=1 SV=1
6	AFDB:Q9U3Y7	0.074	0.099	3.251E-4	1133	0.069	0.094	Q9U3Y7.pdb.gz	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
7	AFDB:F1R5H6	0.072	0.077	4.082E-4	1444	0.066	0.071	F1R5H6.pdb.gz	BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio OX=7955 GN=brd4 PE=1 SV=1
8	AFDB:O60885	0.069	0.078	2.524E-3	1362	0.060	0.069	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
9	AFDB:Q9ESU6	0.070	0.077	3.317E-3	1400	0.056	0.062	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
10	AFDB:F1QV43	0.048	0.052	1.134E-2	1020	0.093	0.142	F1QV43.pdb.gz	F1QV43_DANRE Teashirt homolog 2 isoform X2 OS=Danio rerio OX=7955 GN=tshz2 PE=3 SV=3
11	PDB:5z8lA	0.024	0.160	5.730E-1	204	0.010	0.078	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
12	PDB:5aj0Ao	0.028	0.298	1.960	105	0.005	0.076	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
13	PDB:4xgtA	0.042	0.063	2.821	961	0.017	0.028	4xgtA.pdb.gz
14	PDB:5ikjA	0.045	0.127	2.952	448	0.016	0.056	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
15	PDB:7pqcA	0.026	0.064	3.542	445	0.007	0.025	7pqcA.pdb.gz	A Structural Ensemble of a Tau-Microtubule Complex Reveals Regulatory Tau Phosphorylation and Acetylation Mechanisms.
16	PDB:5o9zH	0.036	0.094	5.099	413	0.015	0.056	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:1x8zA	0.038	0.240	5.585	151	0.007	0.073	1x8zA.pdb.gz
18	PDB:7q83D	0.031	0.193	5.585	156	0.010	0.096	7q83D.pdb.gz
19	PDB:6nr7A	0.023	0.030	6.403	1086	0.016	0.023	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
20	PDB:6nbxF	0.038	0.061	6.701	655	0.015	0.035	6nbxF.pdb.gz	Structure of the complex I-like molecule NDH of oxygenic photosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SHI5	0.0	2741	1557	0.940	0.940	F1SHI5_PIG Bromodomain adjacent to zinc finger domain 1A OS=Sus scrofa OX=9823 GN=BAZ1A PE=4 SV=2
2	O88379	0.0	2535	1555	0.873	0.873	BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus OX=10090 GN=Baz1a PE=1 SV=3
3	Q9NRL2	0.0	3193	1556	1.000	1.000	BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A PE=1 SV=2
4	Q5BI37	4.01e-50	197	1151	0.117	0.158	Q5BI37_DROME LD32807p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
5	Q9Y0W1	6.27e-50	197	1476	0.117	0.123	Q9Y0W1_DROME ATP-dependent chromatin assembly factor large subunit OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
6	Q9V9T4	7.00e-50	197	1476	0.117	0.123	Q9V9T4_DROME ATP-dependent chromatin assembly factor large subunit OS=Drosophila melanogaster OX=7227 GN=Acf PE=1 SV=1
7	Q9NG24	2.54e-49	195	1476	0.116	0.123	Q9NG24_DROME Chromatin accessibility complex (CHRAC) OS=Drosophila melanogaster OX=7227 GN=Acf PE=2 SV=1
8	A2AUY4	3.36e-25	117	2123	0.037	0.027	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
9	J3KPG5	1.71e-24	114	1875	0.061	0.051	J3KPG5_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
10	Q9UIF9	1.73e-24	114	1905	0.061	0.050	BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4
11	F8VU39	1.81e-24	114	1903	0.061	0.050	F8VU39_HUMAN Bromodomain adjacent to zinc finger domain 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=1
12	Q91YE5	6.73e-24	112	1889	0.060	0.050	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
13	Q9UIF8	1.17e-23	112	2168	0.029	0.021	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
14	A1Z8M2	5.67e-21	103	2999	0.026	0.013	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
15	Q960I3	2.07e-20	100	683	0.026	0.059	Q960I3_DROME LP06732p OS=Drosophila melanogaster OX=7227 GN=tou PE=2 SV=1
16	Q9UIG0	4.11e-20	100	1483	0.025	0.026	BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2
17	Q9Z277	5.85e-20	99.8	1479	0.025	0.026	BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus OX=10090 GN=Baz1b PE=1 SV=2
18	F4KB54	1.10e-16	88.2	723	0.036	0.077	F4KB54_ARATH DDT domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAH20.19 PE=1 SV=1
19	Q03330	4.91e-16	85.1	439	0.026	0.093	GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN5 PE=1 SV=1
20	Q23590	7.76e-16	86.3	1390	0.023	0.026	BAZ2_CAEEL Bromodomain adjacent to zinc finger domain protein 2 OS=Caenorhabditis elegans OX=6239 GN=baz-2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00439 Bromodomain	1.5e-16	71.6	Bromodomain
2	PF02791 DDT	4.9e-10	50.8	DDT domain
3	PF00628 PHD	3.8e-10	50.8	PHD-finger
4	PF14446 Prok-RING_1	3.2e+02	12.7	Prokaryotic RING finger family 1
5	PF10537 WAC_Acf1_DNA_bd	2.6e-28	109.8	ATP-utilising chromatin assembly and remodelling N-terminal
6	PF15612 WHIM1	8.9e-08	42.7	WSTF, HB1, Itc1p, MBD9 motif 1
7	PF15613 WSD	2.2e-34	129.3	Williams-Beuren syndrome DDT (WSD), D-TOX E motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283131	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
2	9606.ENSP00000360162	0.999	Probable global transcription activator SNF2L1
3	9606.ENSP00000220913	0.994	Chromatin accessibility complex protein 1
4	9606.ENSP00000363286	0.987	DNA polymerase epsilon subunit 3
5	9606.ENSP00000362592	0.976	Histone-binding protein RBBP4
6	9606.ENSP00000307208	0.946	Nucleosome-remodeling factor subunit BPTF
7	9606.ENSP00000341219	0.942	Cat eye syndrome critical region protein 2
8	9606.ENSP00000448598	0.939	Chromatin complexes subunit BAP18
9	9606.ENSP00000352257	0.917	X-ray repair cross-complementing protein 6
10	9606.ENSP00000216106	0.900	HMG domain-containing protein 4
11	9606.ENSP00000244537	0.837	Histone cluster 1 H4 family member f
12	9606.ENSP00000311513	0.813	Remodeling and spacing factor 1
13	9606.ENSP00000323421	0.774	Structural maintenance of chromosomes protein 1A
14	9606.ENSP00000483667	0.770	Chromodomain-helicase-DNA-binding protein 1
15	9606.ENSP00000395654	0.768	Transcription activator BRG1
16	9606.ENSP00000218089	0.754	Cohesin subunit SA-2
17	9606.ENSP00000350036	0.754	Structural maintenance of chromosomes protein 1B
18	9606.ENSP00000372689	0.744	Cohesin subunit SA-1
19	9606.ENSP00000265773	0.737	Probable global transcription activator SNF2L2
20	9606.ENSP00000420176	0.710	DNA polymerase epsilon subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.365	nucleic acid binding
GO:0003677	0.364	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0006338	0.998	chromatin remodeling
GO:0045935	0.985	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0051054	0.947	positive regulation of DNA metabolic process
GO:0008152	0.938	metabolic process
GO:0044238	0.934	primary metabolic process
GO:0071704	0.933	organic substance metabolic process
GO:0006275	0.927	regulation of DNA replication
GO:0006807	0.915	nitrogen compound metabolic process
GO:0043170	0.906	macromolecule metabolic process
GO:0044237	0.841	cellular metabolic process
GO:0006139	0.826	nucleobase-containing compound metabolic process
GO:0090304	0.779	nucleic acid metabolic process
GO:0045740	0.754	positive regulation of DNA replication
GO:0043933	0.655	protein-containing complex organization
GO:0071824	0.637	protein-DNA complex subunit organization
GO:0022607	0.581	cellular component assembly
GO:0044260	0.548	cellular macromolecule metabolic process
GO:0034728	0.365	nucleosome organization
GO:0006259	0.356	DNA metabolic process
GO:0010468	0.309	regulation of gene expression
GO:0009889	0.303	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0005721	0.999	pericentric heterochromatin
GO:0070603	0.996	SWI/SNF superfamily-type complex
GO:0005654	0.970	nucleoplasm
GO:0031010	0.965	ISWI-type complex
GO:0000228	0.513	nuclear chromosome
GO:0016590	0.491	ACF complex
GO:0008623	0.490	CHRAC

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]