StarFunc result for job id Q9NRM0

User Input

>input (540 residues)
MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVAS
LAGAFGSSFLYGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIG
GLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGV
ALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGLPELLGKESTWPYLFGVIVV
PAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIR
LVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLST
GGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGIL
AIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYC
FLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRM0	1.000	1.000	1.889E-70	540	1.000	1.000	Q9NRM0.pdb.gz	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
2	AFDB:Q3T9X0	0.907	0.911	1.120E-59	538	0.807	0.810	Q3T9X0.pdb.gz	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
3	AFDB:Q9WV38	0.785	0.842	1.530E-36	501	0.400	0.431	Q9WV38.pdb.gz	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
4	AFDB:Q6PXP3	0.798	0.837	1.953E-36	512	0.402	0.424	Q6PXP3.pdb.gz	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
5	AFDB:P22732	0.778	0.834	8.106E-36	501	0.404	0.435	P22732.pdb.gz	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
6	AFDB:P43427	0.775	0.829	8.793E-36	502	0.398	0.428	P43427.pdb.gz	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
7	AFDB:F1NTJ1	0.850	0.923	2.531E-35	496	0.354	0.385	F1NTJ1.pdb.gz	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
8	AFDB:Q9DFV2	0.842	0.903	1.856E-34	503	0.335	0.360	Q9DFV2.pdb.gz	Q9DFV2_SALTR Muscle glucose transporter OS=Salmo trutta OX=8032 PE=2 SV=1
9	AFDB:Q9I8M1	0.859	0.941	8.025E-34	492	0.330	0.362	Q9I8M1.pdb.gz	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
10	AFDB:Q9BYW1	0.767	0.830	3.763E-33	496	0.369	0.401	Q9BYW1.pdb.gz	GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens OX=9606 GN=SLC2A11 PE=2 SV=1
11	PDB:7wsmA	0.829	0.963	5.339E-32	464	0.331	0.386	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
12	PDB:6thaA	0.812	0.977	7.097E-32	448	0.324	0.391	6thaA.pdb.gz
13	PDB:7sptA	0.763	0.868	7.938E-30	470	0.313	0.360	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:4ybqB	0.722	0.831	1.461E-29	462	0.389	0.455	4ybqB.pdb.gz
15	PDB:4gbyA	0.688	0.772	2.493E-18	475	0.191	0.217	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7aaqA	0.697	0.764	4.474E-17	487	0.202	0.224	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.689	0.833	8.361E-16	442	0.196	0.240	4ja4A.pdb.gz
18	PDB:7zh0A	0.529	0.572	2.748E-9	495	0.130	0.141	7zh0A.pdb.gz
19	PDB:5oxpA	0.512	0.584	1.965E-7	462	0.126	0.147	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
20	PDB:6fmrA	0.529	0.591	5.891E-7	475	0.111	0.126	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3T9X0	0.0	886	538	0.817	0.820	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
2	Q9NRM0	0.0	1093	540	1.000	1.000	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
3	P43427	4.41e-143	424	502	0.398	0.428	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
4	Q9WV38	8.88e-142	420	501	0.396	0.427	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
5	Q6PXP3	4.73e-135	403	512	0.396	0.418	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
6	Q9BYW1	1.19e-124	376	496	0.361	0.393	GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens OX=9606 GN=SLC2A11 PE=2 SV=1
7	P22732	2.76e-124	375	501	0.398	0.429	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
8	P46896	2.90e-120	365	490	0.352	0.388	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
9	P27674	3.47e-120	364	492	0.356	0.390	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
10	P11166	4.34e-119	362	492	0.352	0.386	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
11	P17809	5.27e-119	362	492	0.354	0.388	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
12	F1NTJ1	1.08e-118	361	496	0.354	0.385	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2
13	P28568	1.30e-118	360	496	0.354	0.385	GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A3 PE=2 SV=1
14	P11167	2.18e-117	357	492	0.350	0.384	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
15	F1R0Q1	6.27e-116	353	489	0.339	0.374	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
16	A0A060VUB5	6.53e-115	350	480	0.337	0.379	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
17	Q285P3	1.07e-112	345	488	0.326	0.361	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
18	Q9I8M1	2.73e-112	344	492	0.337	0.370	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
19	A0A060WJ53	5.45e-104	322	477	0.320	0.363	A0A060WJ53_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00006116001 PE=4 SV=1
20	P11169	9.33e-103	320	496	0.311	0.339	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	3.1e-21	87.3	Major Facilitator Superfamily
2	PF00083 Sugar_tr	3.2e-102	354.4	Sugar (and other) transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264784

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366797	0.922	Solute carrier family 22 member 12
2	9606.ENSP00000244527	0.863	Sodium-dependent phosphate transport protein 1
3	9606.ENSP00000301891	0.851	Solute carrier family 22 member 11
4	9606.ENSP00000380250	0.840	Sodium-dependent phosphate transport protein 4
5	9606.ENSP00000237612	0.814	ATP-binding cassette sub-family G member 2
6	9606.ENSP00000331983	0.806	F-actin-uncapping protein LRRC16A
7	9606.ENSP00000293350	0.788	Aldehyde dehydrogenase 16 family member A1
8	9606.ENSP00000394485	0.766	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
9	9606.ENSP00000378757	0.764	Monocarboxylate transporter 9
10	9606.ENSP00000337335	0.750	Solute carrier family 22 member 8
11	9606.ENSP00000310241	0.745	Solute carrier family 22 member 13
12	9606.ENSP00000367102	0.728	Solute carrier family 22 member 6
13	9606.ENSP00000313050	0.672	Protein NipSnap homolog 2
14	9606.ENSP00000204566	0.671	Maspardin
15	9606.ENSP00000386213	0.660	Myosin-IIIb
16	9606.ENSP00000327943	0.656	Sodium/glucose cotransporter 2
17	9606.ENSP00000274353	0.654	Betaine--homocysteine S-methyltransferase 1
18	9606.ENSP00000280057	0.652	Protein FAM124A
19	9606.ENSP00000367137	0.647	Probable small intestine urate exporter
20	9606.ENSP00000278590	0.643	Probable ribonuclease ZC3H12C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005355	1.000	glucose transmembrane transporter activity
GO:1901702	0.999	salt transmembrane transporter activity
GO:0005353	0.993	fructose transmembrane transporter activity
GO:0005488	0.984	binding
GO:0005515	0.859	protein binding
GO:0022804	0.814	active transmembrane transporter activity
GO:0015291	0.740	secondary active transmembrane transporter activity
GO:0015318	0.719	inorganic molecular entity transmembrane transporter activity
GO:0008514	0.676	organic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034219	0.995	carbohydrate transmembrane transport
GO:0015749	0.993	monosaccharide transmembrane transport
GO:0008645	0.937	hexose transmembrane transport
GO:1904659	0.781	glucose transmembrane transport
GO:0008152	0.738	metabolic process
GO:0015711	0.628	organic anion transport
GO:0071704	0.569	organic substance metabolic process
GO:0044237	0.529	cellular metabolic process
GO:0006807	0.455	nitrogen compound metabolic process
GO:0071705	0.420	nitrogen compound transport
GO:1901564	0.367	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.846	membrane-bounded organelle
GO:0005622	0.784	intracellular anatomical structure
GO:0043229	0.722	intracellular organelle
GO:0043231	0.676	intracellular membrane-bounded organelle
GO:0005737	0.603	cytoplasm
GO:0098590	0.549	plasma membrane region
GO:0045178	0.339	basal part of cell
GO:0009925	0.333	basal plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]