StarFunc result for job id Q9NRM1

User Input

>input (1142 residues)
MLVLRCRLGTSFPKLDNLVPKGKMKILLVFLGLLGNSVAMPMHMPRMPGFSSKSEEMMRY
NQFNFMNGPHMAHLGPFFGNGLPQQFPQYQMPMWPQPPPNTWHPRKSSAPKRHNKTDQTQ
ETQKPNQTQSKKPPQKRPLKQPSHNQPQPEEEAQPPQAFPPFGNGLFPYQQPPWQIPQRL
PPPGYGRPPISNEEGGNPYFGYFGYHGFGGRPPYYSEEMFEQDFEKPKEEDPPKAESPGT
EPTANSTVTETNSTQPNPKGSQGGNDTSPTGNSTPGLNTGNNPPAQNGIGPLPAVNASGQ
GGPGSQIPWRPSQPNIRENHPYPNIRNFPSGRQWYFTGTVMGHRQNRPFYRNQQVQRGPR
WNFFAWERKQVARPGNPVYHKAYPPTSRGNYPNYAGNPANLRRKPQGPNKHPVGTTVAPL
GPKPGPVVRNEKIQNPKEKPLGPKEQIIVPTKNPTSPWRNSQQYEVNKSNYKLPHSEGYM
PVPNFNSVDQHENSYYPRGDSRKVPNSDGQTQSQNLPKGIVLGSRRMPYESETNQSELKH
SSYQPAVYPEEIPSPAKEHFPAGRNTWDHQEISPPFKEDPGRQEEHLPHPSHGSRGSVFY
PEYNPYDPRENSPYLRGNTWDERDDSPNTMGQKESPLYPINTPDQKEIVPYNEEDPVDPT
GDEVFPGQNRWGEELSFKGGPTVRHYEGEQYTSNQPKEYLPYSLDNPSKPREDFYYSEFY
PWSPDENFPSYNTASTMPPPIESRGYYVNNAAGPEESTLFPSRNSWDHRIQAQGQRERRP
YFNRNIWDQATHLQKAPARPPDQKGNQPYYSNTPAGLQKNPIWHEGENLNYGMQITRMNS
PEREHSSFPNFIPPSYPSGQKEAHLFHLSQRGSCCAGSSTGPKDNPLALQDYTPSYGLAP
GENQDTSPLYTDGSHTKQTRDIISPTSILPGQRNSSEKRESQNPFRDDVSTLRRNTPCSI
KNQLGQKEIMPFPEASSLQSKNTPCLKNDLGGDGNNILEQVFEDNQLNERTVDLTPEQLV
IGTPDEGSNPEGIQSQVQENESERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQS
PFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLL
QA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRM1	1.000	1.000	0.000	1142	1.000	1.000	Q9NRM1.pdb.gz	ENAM_HUMAN Enamelin OS=Homo sapiens OX=9606 GN=ENAM PE=1 SV=3
2	AFDB:O55196	0.039	0.036	4.323E-68	1274	0.615	0.551	O55196.pdb.gz	ENAM_MOUSE Enamelin OS=Mus musculus OX=10090 GN=Enam PE=1 SV=1
3	AFDB:P49750	0.035	0.023	3.811E-2	2146	0.177	0.094	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
4	AFDB:Q8CJF7	0.040	0.026	7.730E-2	2243	0.163	0.083	Q8CJF7.pdb.gz	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1
5	AFDB:F1QSH8	0.043	0.027	8.296E-2	1553	0.148	0.109	F1QSH8.pdb.gz
6	AFDB:Q9V4F9	0.039	0.033	8.904E-2	1483	0.158	0.122	Q9V4F9.pdb.gz	MED26_DROME Mediator of RNA polymerase II transcription subunit 26 OS=Drosophila melanogaster OX=7227 GN=MED26 PE=1 SV=2
7	AFDB:A0A1D8PGF8	0.037	0.032	2.233E-1	1409	0.152	0.123	A0A1D8PGF8.pdb.gz	A0A1D8PGF8_CANAL Msb2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB2 PE=4 SV=1
8	AFDB:Q9FMM3	0.035	0.025	3.663E-1	1714	0.172	0.114	Q9FMM3.pdb.gz	EXA1_ARATH Protein ESSENTIAL FOR POTEXVIRUS ACCUMULATION 1 OS=Arabidopsis thaliana OX=3702 GN=EXA1 PE=1 SV=1
9	AFDB:E9Q4N7	0.034	0.020	4.220E-1	2244	0.183	0.093	E9Q4N7.pdb.gz	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
10	AFDB:P02467	0.043	0.037	4.220E-1	1363	0.175	0.147	P02467.pdb.gz	CO1A2_CHICK Collagen alpha-2(I) chain OS=Gallus gallus OX=9031 GN=COL1A2 PE=1 SV=3
11	PDB:6hivDH	0.030	0.055	6.552	564	0.004	0.009	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:1rquA	0.023	0.141	9.332	120	0.004	0.033	1rquA.pdb.gz
13	PDB:7mq8SB	0.028	0.053	9.332	440	0.006	0.016	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55196	0.0	825	1274	0.391	0.350	ENAM_MOUSE Enamelin OS=Mus musculus OX=10090 GN=Enam PE=1 SV=1
2	Q9NRM1	0.0	2327	1142	1.000	1.000	ENAM_HUMAN Enamelin OS=Homo sapiens OX=9606 GN=ENAM PE=1 SV=3
3	Q9KS12	0.26	38.1	4558	0.034	0.009	MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=rtxA PE=1 SV=2
4	Q09857	3.2	34.3	1067	0.031	0.033	USO1_SCHPO Intracellular protein transport protein uso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uso1 PE=3 SV=3
5	O43024	6.7	33.5	963	0.036	0.043	DEF1_SCHPO RNA polymerase II degradation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=def1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15362 Enamelin	0	1662.0	Enamelin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370088	0.986	Amelogenin, X isoform
2	9606.ENSP00000313809	0.968	Ameloblastin
3	9606.ENSP00000341013	0.904	Amelotin
4	9606.ENSP00000260228	0.891	Matrix metalloproteinase-20
5	9606.ENSP00000326159	0.856	Kallikrein-4
6	9606.ENSP00000379401	0.831	Odontogenic ameloblast-associated protein
7	9606.ENSP00000373565	0.819	Protein FAM83H
8	9606.ENSP00000357842	0.812	Tuftelin
9	9606.ENSP00000379619	0.775	WD repeat-containing protein 72
10	9606.ENSP00000337816	0.758	Matrix metalloproteinase-25
11	9606.ENSP00000468308	0.750	Pseudokinase FAM20A
12	9606.ENSP00000406925	0.747	Odontogenesis associated phosphoprotein
13	9606.ENSP00000382213	0.721	Dentin sialophosphoprotein
14	9606.ENSP00000261007	0.676	Acetylcholine receptor subunit alpha
15	9606.ENSP00000322323	0.673	Extracellular serine/threonine protein kinase FAM20C
16	9606.ENSP00000384421	0.620	Tuftelin-interacting protein 11
17	9606.ENSP00000389870	0.606	Homeobox protein DLX-3
18	9606.ENSP00000431840	0.604	Sodium/potassium/calcium exchanger 4
19	9606.ENSP00000270593	0.593	Testicular acid phosphatase
20	9606.ENSP00000367762	0.588	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.988	anatomical structure development
GO:0050789	0.985	regulation of biological process
GO:0009987	0.984	cellular process
GO:0048518	0.953	positive regulation of biological process
GO:0048513	0.937	animal organ development
GO:0042476	0.853	odontogenesis
GO:0009888	0.846	tissue development
GO:0050794	0.685	regulation of cellular process
GO:0050793	0.627	regulation of developmental process
GO:0042475	0.556	odontogenesis of dentin-containing tooth
GO:0030154	0.524	cell differentiation
GO:0051239	0.470	regulation of multicellular organismal process
GO:0051094	0.453	positive regulation of developmental process
GO:0070167	0.439	regulation of biomineral tissue development
GO:0048646	0.343	anatomical structure formation involved in morphogenesis
GO:0070169	0.316	positive regulation of biomineral tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005788	0.996	endoplasmic reticulum lumen
GO:0071944	0.722	cell periphery
GO:0031012	0.453	extracellular matrix
GO:0031981	0.337	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]