StarFunc result for job id Q9NRM6

User Input

>input (502 residues)
MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATG
DYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWT
FSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLW
DPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVT
GDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLV
ATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICYFTEFLQNHCR
SEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ
DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELL
HVKQQVSAGKRSQACHDGCCSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRM6	1.000	1.000	2.986E-102	502	1.000	1.000	Q9NRM6.pdb.gz	I17RB_HUMAN Interleukin-17 receptor B OS=Homo sapiens OX=9606 GN=IL17RB PE=1 SV=2
2	AFDB:Q9JIP3	0.749	0.753	6.850E-79	499	0.745	0.749	Q9JIP3.pdb.gz	I17RB_MOUSE Interleukin-17 receptor B OS=Mus musculus OX=10090 GN=Il17rb PE=1 SV=1
3	AFDB:D4A740	0.419	0.263	2.390E-38	868	0.245	0.142	D4A740.pdb.gz	D4A740_RAT Interleukin 17 receptor A OS=Rattus norvegicus OX=10116 GN=Il17ra PE=4 SV=2
4	AFDB:Q60943	0.414	0.261	5.102E-37	864	0.255	0.148	Q60943.pdb.gz	I17RA_MOUSE Interleukin-17 receptor A OS=Mus musculus OX=10090 GN=Il17ra PE=1 SV=1
5	AFDB:Q96F46	0.409	0.255	5.102E-37	866	0.235	0.136	Q96F46.pdb.gz	I17RA_HUMAN Interleukin-17 receptor A OS=Homo sapiens OX=9606 GN=IL17RA PE=1 SV=2
6	AFDB:Q8QHJ9	0.324	0.232	9.064E-26	745	0.161	0.109	Q8QHJ9.pdb.gz	I17RD_DANRE Interleukin-17 receptor D OS=Danio rerio OX=7955 GN=il17rd PE=1 SV=2
7	AFDB:Q8JZL1	0.324	0.235	2.980E-25	738	0.173	0.118	Q8JZL1.pdb.gz	I17RD_MOUSE Interleukin-17 receptor D OS=Mus musculus OX=10090 GN=Il17rd PE=1 SV=1
8	AFDB:Q8NFM7	0.326	0.237	7.811E-25	739	0.177	0.120	Q8NFM7.pdb.gz	I17RD_HUMAN Interleukin-17 receptor D OS=Homo sapiens OX=9606 GN=IL17RD PE=1 SV=3
9	AFDB:Q9NA64	0.255	0.157	7.435E-22	846	0.159	0.095	Q9NA64.pdb.gz	ILCR1_CAEEL Interleukin cytokine receptor-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=ilcr-1 PE=1 SV=1
10	AFDB:Q10128	0.257	0.184	1.922E-19	718	0.159	0.111	Q10128.pdb.gz	ILCR2_CAEEL Interleukin cytokine receptor-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=ilcr-2 PE=1 SV=1
11	PDB:5mhlA	0.169	0.136	8.453E-6	692	0.036	0.026	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
12	PDB:1f13A	0.252	0.186	1.577E-5	722	0.032	0.022	1f13A.pdb.gz
13	PDB:1l9mB	0.245	0.191	4.899E-5	681	0.062	0.046	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
14	PDB:3gc3A	0.138	0.190	1.359E-4	329	0.070	0.106	3gc3A.pdb.gz
15	PDB:2wtrB	0.148	0.188	1.438E-4	367	0.076	0.104	2wtrB.pdb.gz
16	PDB:6kzbC	0.198	0.160	1.611E-4	649	0.046	0.035	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
17	PDB:5c6wJ	0.122	0.229	2.263E-4	238	0.060	0.126	5c6wJ.pdb.gz
18	PDB:2q3zA	0.233	0.187	5.932E-4	655	0.038	0.029	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
19	PDB:4pygA	0.216	0.169	9.336E-4	685	0.042	0.031	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
20	PDB:7u7nC	0.157	0.284	1.312E-3	200	0.062	0.155	7u7nC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9IZN0	0.0	716	348	0.693	1.000	C9IZN0_HUMAN Interleukin 17 receptor B (Fragment) OS=Homo sapiens OX=9606 GN=IL17RB PE=1 SV=1
2	Q9JIP3	0.0	754	499	0.739	0.743	I17RB_MOUSE Interleukin-17 receptor B OS=Mus musculus OX=10090 GN=Il17rb PE=1 SV=1
3	Q9NRM6	0.0	1048	502	1.000	1.000	I17RB_HUMAN Interleukin-17 receptor B OS=Homo sapiens OX=9606 GN=IL17RB PE=1 SV=2
4	Q96F46	2.92e-37	148	866	0.245	0.142	I17RA_HUMAN Interleukin-17 receptor A OS=Homo sapiens OX=9606 GN=IL17RA PE=1 SV=2
5	Q60943	2.83e-36	145	864	0.251	0.146	I17RA_MOUSE Interleukin-17 receptor A OS=Mus musculus OX=10090 GN=Il17ra PE=1 SV=1
6	D4A740	2.76e-35	142	868	0.237	0.137	D4A740_RAT Interleukin 17 receptor A OS=Rattus norvegicus OX=10116 GN=Il17ra PE=4 SV=2
7	Q8QHJ9	3.57e-06	52.0	745	0.092	0.062	I17RD_DANRE Interleukin-17 receptor D OS=Danio rerio OX=7955 GN=il17rd PE=1 SV=2
8	Q8JZL1	5.63e-06	51.6	738	0.098	0.066	I17RD_MOUSE Interleukin-17 receptor D OS=Mus musculus OX=10090 GN=Il17rd PE=1 SV=1
9	Q8NFM7	3.96e-04	45.4	739	0.092	0.062	I17RD_HUMAN Interleukin-17 receptor D OS=Homo sapiens OX=9606 GN=IL17RD PE=1 SV=3
10	Q90688	0.93	34.7	1272	0.050	0.020	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
11	Q54V07	1.7	33.9	902	0.044	0.024	TGRB1_DICDI Tiger protein B1 OS=Dictyostelium discoideum OX=44689 GN=tgrB1 PE=3 SV=1
12	Q10128	2.3	33.5	718	0.062	0.043	ILCR2_CAEEL Interleukin cytokine receptor-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=ilcr-2 PE=1 SV=1
13	O07755	5.5	31.6	228	0.026	0.057	O07755_MYCTU EthD domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1874 PE=1 SV=1
14	E9QAM5	7.8	32.0	2947	0.052	0.009	HELZ2_MOUSE Helicase with zinc finger domain 2 OS=Mus musculus OX=10090 GN=Helz2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16556 IL17R_fnIII_D1	7.6e-19	79.3	Interleukin-17 receptor, fibronectin-III-like domain 1
2	PF16578 IL17R_fnIII_D2	7.4e-08	44.2	Interleukin 17 receptor D
3	PF08357 SEFIR	9.7e-46	167.2	SEFIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328111	0.998	Interleukin-25
2	9606.ENSP00000261796	0.997	Interleukin-17B
3	9606.ENSP00000295981	0.974	Interleukin-17 receptor C
4	9606.ENSP00000433623	0.949	TNF receptor-associated factor 6
5	9606.ENSP00000344192	0.881	Interleukin-17A
6	9606.ENSP00000373325	0.868	Interleukin-17 receptor E
7	9606.ENSP00000320936	0.865	Interleukin-17 receptor A
8	9606.ENSP00000244241	0.828	Interleukin-17C
9	9606.ENSP00000302924	0.773	Interleukin-17D
10	9606.ENSP00000337432	0.758	Interleukin-17F
11	9606.ENSP00000339804	0.723	Thymic stromal lymphopoietin
12	9606.ENSP00000290295	0.703	Homeobox protein Hox-B13
13	9606.ENSP00000357750	0.693	Adapter protein CIKS
14	9606.ENSP00000370842	0.667	Interleukin-33
15	9606.ENSP00000304915	0.657	Interleukin-13
16	9606.ENSP00000233954	0.636	Interleukin-1 receptor-like 1
17	9606.ENSP00000231454	0.626	Interleukin-5
18	9606.ENSP00000448051	0.616	DAZ associated protein 2
19	9606.ENSP00000368632	0.595	Trans-acting T-cell-specific transcription factor GATA-3
20	9606.ENSP00000231449	0.567	Interleukin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0006950	0.949	response to stress
GO:0006952	0.944	defense response
GO:0050789	0.931	regulation of biological process
GO:0048518	0.869	positive regulation of biological process
GO:0019222	0.814	regulation of metabolic process
GO:0009987	0.806	cellular process
GO:0060255	0.746	regulation of macromolecule metabolic process
GO:0050794	0.726	regulation of cellular process
GO:0048583	0.720	regulation of response to stimulus
GO:0010468	0.678	regulation of gene expression
GO:0009893	0.639	positive regulation of metabolic process
GO:0010604	0.589	positive regulation of macromolecule metabolic process
GO:0051239	0.573	regulation of multicellular organismal process
GO:0051716	0.522	cellular response to stimulus
GO:0051240	0.502	positive regulation of multicellular organismal process
GO:0001817	0.490	regulation of cytokine production
GO:0001819	0.484	positive regulation of cytokine production
GO:0048584	0.449	positive regulation of response to stimulus
GO:0031347	0.376	regulation of defense response
GO:0032101	0.336	regulation of response to external stimulus
GO:0050727	0.331	regulation of inflammatory response
GO:0023052	0.328	signaling
GO:0007154	0.328	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.717	cytoplasm
GO:0070013	0.459	intracellular organelle lumen
GO:0031981	0.424	nuclear lumen
GO:0005654	0.386	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]