StarFunc result for job id Q9NRM7

User Input

>input (1088 residues)
MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQ
QQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRA
LKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSF
ASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVE
AAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGA
GLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLY
ELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPA
AEGLDAKEEHALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGM
EQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPY
AFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKR
AKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDIL
AEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIE
SVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVG
VILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLG
RNGADDLKAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTK
AWDTLTSPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEASQAESSDLESSDLVDQT
EGCQPVYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDM3	0.414	0.414	0.000	1088	1.000	1.000	A0A024RDM3.pdb.gz
2	AFDB:Q7TSJ6	0.472	0.492	0.000	1042	0.824	0.861	Q7TSJ6.pdb.gz	LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus OX=10090 GN=Lats2 PE=1 SV=1
3	AFDB:A0A2R8QF71	0.502	0.482	5.145E-92	1140	0.652	0.622	A0A2R8QF71.pdb.gz
4	AFDB:B2BJC0	0.419	0.423	5.403E-91	1078	0.646	0.652	B2BJC0.pdb.gz	B2BJC0_DANRE Lats2-2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
5	AFDB:A0A2R8QB11	0.432	0.445	7.660E-90	1054	0.639	0.659	A0A2R8QB11.pdb.gz
6	AFDB:O95835	0.446	0.430	7.964E-80	1130	0.541	0.521	O95835.pdb.gz	LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1
7	AFDB:Q58FB8	0.410	0.417	9.110E-66	1068	0.501	0.510	Q58FB8.pdb.gz	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
8	PDB:6byrA	0.259	0.682	2.199E-23	405	0.118	0.316	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
9	PDB:5x3fB	0.236	0.704	1.627E-22	349	0.108	0.338	5x3fB.pdb.gz
10	AFDB:Q9VUQ9	0.278	0.145	2.885E-22	2139	0.230	0.117	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
11	AFDB:P53739	0.267	0.322	5.528E-22	893	0.192	0.234	P53739.pdb.gz	FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPK1 PE=1 SV=1
12	PDB:4c0tA	0.242	0.858	1.983E-20	291	0.091	0.340	4c0tA.pdb.gz
13	PDB:3pvuA	0.240	0.421	3.995E-20	609	0.094	0.167	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
14	PDB:6pjxA	0.254	0.498	4.880E-20	543	0.092	0.184	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:3nynA	0.256	0.495	5.670E-20	554	0.097	0.190	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
16	PDB:3c4wB	0.256	0.524	7.282E-20	519	0.089	0.187	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:4mk0A	0.254	0.426	1.034E-19	631	0.097	0.166	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:3pfqA	0.239	0.489	1.884E-19	523	0.097	0.201	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
19	PDB:4yhjA	0.252	0.533	8.039E-19	501	0.091	0.198	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
20	AFDB:M9PDQ2	0.226	0.242	3.493E-14	1011	0.152	0.163	M9PDQ2.pdb.gz	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0S8I4	0.0	1285	1140	0.650	0.620	B0S8I4_DANRE Large tumor suppressor kinase 2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=4 SV=1
2	B2BJC0	0.0	1288	1078	0.642	0.648	B2BJC0_DANRE Lats2-2 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
3	B2BJC1	0.0	1281	1140	0.648	0.618	B2BJC1_DANRE Lats2-1 OS=Danio rerio OX=7955 GN=si:ch211-173o4.2 PE=2 SV=1
4	Q58FB8	0.0	879	1068	0.503	0.512	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
5	Q5RIL6	0.0	883	1068	0.505	0.514	Q5RIL6_DANRE LATS, large tumor suppressor, homolog 1 (Drosophila) OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
6	Q7TSJ6	0.0	1757	1042	0.826	0.863	LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus OX=10090 GN=Lats2 PE=1 SV=1
7	Q8BYR2	0.0	929	1129	0.436	0.420	LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus OX=10090 GN=Lats1 PE=1 SV=3
8	Q9NRM7	0.0	2256	1088	1.000	1.000	LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens OX=9606 GN=LATS2 PE=1 SV=2
9	Q9VA38	0.0	636	1105	0.281	0.277	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
10	O45797	1.65e-134	432	908	0.210	0.251	WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans OX=6239 GN=wts-1 PE=1 SV=1
11	Q9Y2H1	5.76e-126	394	464	0.179	0.420	ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens OX=9606 GN=STK38L PE=1 SV=3
12	A4GW50	6.16e-125	392	464	0.178	0.418	A4GW50_RAT Serine/threonine kinase 38 like OS=Rattus norvegicus OX=10116 GN=Stk38l PE=1 SV=1
13	Q7TSE6	1.04e-124	391	464	0.177	0.416	ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus OX=10090 GN=Stk38l PE=1 SV=2
14	Q54Y26	1.14e-124	394	530	0.181	0.372	NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum OX=44689 GN=ndrA PE=3 SV=1
15	Q15208	1.23e-124	391	465	0.186	0.434	STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1
16	Q5AP53	7.40e-124	398	732	0.188	0.279	CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CBK1 PE=1 SV=2
17	A0A0U1RS40	8.57e-124	393	572	0.186	0.353	A0A0U1RS40_RAT Serine/threonine kinase 38 OS=Rattus norvegicus OX=10116 GN=Stk38 PE=1 SV=1
18	A0A8I5ZLY4	1.08e-123	389	473	0.186	0.427	A0A8I5ZLY4_RAT Serine/threonine kinase 38 OS=Rattus norvegicus OX=10116 GN=Stk38 PE=1 SV=1
19	Q9NBK5	1.61e-123	388	463	0.182	0.428	TRC_DROME Serine/threonine-protein kinase tricornered OS=Drosophila melanogaster OX=7227 GN=trc PE=1 SV=1
20	G3V9Q4	3.69e-123	392	599	0.186	0.337	G3V9Q4_RAT Serine/threonine kinase 38 OS=Rattus norvegicus OX=10116 GN=Stk38 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.39	21.3	ABC1 atypical kinase-like domain
2	PF01636 APH	43	15.4	Phosphotransferase enzyme family
3	PF19043 CBP66	1.4e+02	12.5	Nuclear cap binding complex subunit CBP66
4	PF12330 Haspin_kinase	1.5e+02	12.8	Haspin like kinase domain
5	PF06293 Kdo	1.6e+02	13.1	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	2e+02	12.7	Kinase-like
7	PF00069 Pkinase	4.7e-58	208.2	Protein kinase domain
8	PF00433 Pkinase_C	0.075	25.0	Protein kinase C terminal domain
9	PF07714 PK_Tyr_Ser-Thr	2.9e-25	100.6	Protein tyrosine and serine/threonine kinase
10	PF05445 Pox_ser-thr_kin	90	13.5	Poxvirus serine/threonine protein kinase
11	PF00627 UBA	24	16.2	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372035

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478927	0.999	Transcriptional coactivator YAP1
2	9606.ENSP00000379364	0.998	MOB kinase activator 1A
3	9606.ENSP00000324729	0.997	Protein salvador homolog 1
4	9606.ENSP00000361892	0.994	Serine/threonine-protein kinase 4
5	9606.ENSP00000429744	0.994	Serine/threonine-protein kinase 3
6	9606.ENSP00000344666	0.992	Merlin
7	9606.ENSP00000361027	0.992	Angiomotin
8	9606.ENSP00000379366	0.990	MOB kinase activator 1B
9	9606.ENSP00000258149	0.983	E3 ubiquitin-protein ligase Mdm2
10	9606.ENSP00000419465	0.983	WW domain-containing transcription regulator protein 1
11	9606.ENSP00000427772	0.982	Protein KIBRA
12	9606.ENSP00000424765	0.970	Angiomotin-like protein 2
13	9606.ENSP00000273317	0.966	LIM domain-containing protein 1
14	9606.ENSP00000466953	0.960	Wilms tumor protein 1-interacting protein
15	9606.ENSP00000262713	0.954	LIM domain-containing protein ajuba
16	9606.ENSP00000437550	0.949	Serine/threonine-protein kinase LATS1
17	9606.ENSP00000387739	0.876	Angiomotin-like protein 1
18	9606.ENSP00000343899	0.850	FERM domain containing 6
19	9606.ENSP00000322457	0.847	E3 ubiquitin-protein ligase SIAH2
20	9606.ENSP00000435233	0.827	Transcriptional enhancer factor TEF-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0005524	0.996	ATP binding
GO:0019899	0.668	enzyme binding
GO:0008134	0.559	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0008152	0.970	metabolic process
GO:0051716	0.970	cellular response to stimulus
GO:0019222	0.967	regulation of metabolic process
GO:0007154	0.957	cell communication
GO:0023052	0.952	signaling
GO:0044237	0.951	cellular metabolic process
GO:0007165	0.926	signal transduction
GO:0006793	0.908	phosphorus metabolic process
GO:0071495	0.904	cellular response to endogenous stimulus
GO:0048583	0.890	regulation of response to stimulus
GO:0035556	0.887	intracellular signal transduction
GO:0023051	0.879	regulation of signaling
GO:0006796	0.859	phosphate-containing compound metabolic process
GO:0060255	0.837	regulation of macromolecule metabolic process
GO:0051171	0.833	regulation of nitrogen compound metabolic process
GO:0048518	0.827	positive regulation of biological process
GO:0031323	0.825	regulation of cellular metabolic process
GO:0071704	0.824	organic substance metabolic process
GO:0080090	0.824	regulation of primary metabolic process
GO:0048519	0.810	negative regulation of biological process
GO:0048523	0.802	negative regulation of cellular process
GO:0044238	0.796	primary metabolic process
GO:0016310	0.794	phosphorylation
GO:0010646	0.780	regulation of cell communication
GO:0006807	0.750	nitrogen compound metabolic process
GO:0048856	0.739	anatomical structure development
GO:0043170	0.735	macromolecule metabolic process
GO:0006468	0.711	protein phosphorylation
GO:0009966	0.666	regulation of signal transduction
GO:0048522	0.612	positive regulation of cellular process
GO:0032501	0.600	multicellular organismal process
GO:0065009	0.505	regulation of molecular function
GO:0010468	0.504	regulation of gene expression
GO:0010605	0.469	negative regulation of macromolecule metabolic process
GO:0009968	0.459	negative regulation of signal transduction
GO:0051246	0.456	regulation of protein metabolic process
GO:0051172	0.446	negative regulation of nitrogen compound metabolic process
GO:0007275	0.418	multicellular organism development
GO:0031324	0.396	negative regulation of cellular metabolic process
GO:0019219	0.375	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.369	cellular component organization or biogenesis
GO:0009889	0.359	regulation of biosynthetic process
GO:0031326	0.352	regulation of cellular biosynthetic process
GO:0010556	0.351	regulation of macromolecule biosynthetic process
GO:0051252	0.345	regulation of RNA metabolic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0016043	0.323	cellular component organization
GO:0006355	0.316	regulation of DNA-templated transcription
GO:1902531	0.308	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005856	0.999	cytoskeleton
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.994	nucleus
GO:0015630	0.994	microtubule cytoskeleton
GO:0031981	0.891	nuclear lumen
GO:0005654	0.882	nucleoplasm
GO:0034451	0.800	centriolar satellite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]