StarFunc result for job id Q9NRP7

User Input

>input (1315 residues)
MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRH
PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR
ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT
ADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKNFLQGLLTKDPR
QRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
ILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILAS
ELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEW
QHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLS
SLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFA
CTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGN
SRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISS
ALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYS
CCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLVFRLQNLPCGM
EKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRL
TPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEG
ELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLC
PSFLNQLRQAPHGSEFLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQV
CCYHLPLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQPLLTSD
LLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSVRAHTYRLLGHLLQHS
MALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQL
LGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSL
QQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q69ZM6	0.698	0.697	0.000	1316	0.848	0.847	Q69ZM6.pdb.gz	STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus OX=10090 GN=Stk36 PE=1 SV=3
2	AFDB:Q9NRP7	1.000	1.000	0.000	1315	1.000	1.000	Q9NRP7.pdb.gz	STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens OX=9606 GN=STK36 PE=1 SV=2
3	AFDB:A8WFS2	0.322	0.343	6.719E-45	1231	0.320	0.342	A8WFS2.pdb.gz	A8WFS2_DANRE Serine/threonine kinase 36 (fused homolog, Drosophila) OS=Danio rerio OX=7955 GN=fu PE=2 SV=1
4	AFDB:Q2QAV0	0.307	0.306	7.344E-40	1322	0.253	0.252	Q2QAV0.pdb.gz	TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana OX=3702 GN=TIO PE=1 SV=1
5	AFDB:Q55FT4	0.369	0.227	2.241E-27	2247	0.257	0.150	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
6	AFDB:Q384K4	0.205	0.215	2.694E-24	1253	0.184	0.193	Q384K4.pdb.gz	Q384K4_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0400 PE=4 SV=1
7	AFDB:P23647	0.204	0.331	4.837E-24	805	0.169	0.276	P23647.pdb.gz	FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster OX=7227 GN=fu PE=1 SV=2
8	AFDB:A0A078CGE6	0.191	0.193	6.230E-21	1299	0.173	0.176	A0A078CGE6.pdb.gz	M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus OX=3708 GN=M3KE1 PE=1 SV=1
9	AFDB:Q9SFB6	0.203	0.197	2.305E-20	1367	0.188	0.181	Q9SFB6.pdb.gz	M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MAP3KE2 PE=2 SV=1
10	AFDB:P41892	0.202	0.244	5.266E-20	1062	0.162	0.201	P41892.pdb.gz	CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc7 PE=1 SV=1
11	PDB:7myjC	0.187	0.509	4.239E-14	465	0.068	0.191	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
12	PDB:5u6yA	0.186	0.514	5.036E-14	459	0.075	0.214	5u6yA.pdb.gz
13	PDB:6b1uA	0.190	0.544	9.686E-14	442	0.067	0.199	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
14	PDB:5x3fB	0.185	0.676	1.074E-13	349	0.063	0.238	5x3fB.pdb.gz
15	PDB:4eomC	0.184	0.824	1.928E-13	276	0.069	0.330	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:4rerA	0.189	0.526	2.066E-13	459	0.066	0.190	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5ufuA	0.187	0.643	2.290E-13	369	0.060	0.214	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:4rewA	0.182	0.566	3.839E-13	411	0.063	0.202	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:1unlA	0.183	0.785	4.885E-13	292	0.064	0.288	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4zhxA	0.185	0.576	4.885E-13	409	0.065	0.210	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJW1	0.0	2658	1315	1.000	1.000	A0A140VJW1_HUMAN Testicular tissue protein Li 188 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q69ZM6	0.0	2120	1316	0.849	0.848	STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus OX=10090 GN=Stk36 PE=1 SV=3
3	Q9NRP7	0.0	2658	1315	1.000	1.000	STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens OX=9606 GN=STK36 PE=1 SV=2
4	A8WFS2	5.94e-152	493	1231	0.210	0.224	A8WFS2_DANRE Serine/threonine kinase 36 (fused homolog, Drosophila) OS=Danio rerio OX=7955 GN=fu PE=2 SV=1
5	Q2QAV0	7.61e-109	376	1322	0.126	0.126	TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana OX=3702 GN=TIO PE=1 SV=1
6	P23647	1.37e-89	311	805	0.113	0.184	FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster OX=7227 GN=fu PE=1 SV=2
7	Q55FT4	2.35e-78	288	2247	0.094	0.055	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
8	F4JY37	2.29e-52	204	1366	0.091	0.088	RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana OX=3702 GN=RUK PE=1 SV=1
9	Q54WX4	2.50e-50	185	384	0.078	0.268	AURK_DICDI Aurora kinase OS=Dictyostelium discoideum OX=44689 GN=aurK PE=1 SV=1
10	O64629	1.44e-47	174	288	0.073	0.333	AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana OX=3702 GN=AUR3 PE=2 SV=1
11	Q9UQB9	6.12e-47	173	309	0.074	0.314	AURKC_HUMAN Aurora kinase C OS=Homo sapiens OX=9606 GN=AURKC PE=1 SV=1
12	J9W0G9	1.75e-46	179	575	0.072	0.165	YPK1_CRYNH Serine/threonine-protein kinase YPK1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=YPK1 PE=1 SV=1
13	F1MY86	3.53e-46	171	304	0.072	0.312	F1MY86_BOVIN Aurora kinase OS=Bos taurus OX=9913 GN=AURKC PE=3 SV=2
14	Q388U5	3.96e-45	169	337	0.071	0.276	Q388U5_TRYB2 Protein kinase A catalytic subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0490 PE=3 SV=1
15	Q8WSK3	4.07e-45	168	337	0.071	0.276	Q8WSK3_TRYBB Protein kinase A catalytic subunit OS=Trypanosoma brucei brucei OX=5702 GN=PKA3 PE=3 SV=2
16	Q9SEZ7	4.17e-45	172	469	0.073	0.205	CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana OX=3702 GN=CIPK16 PE=1 SV=1
17	Q6PHR2	8.96e-45	171	472	0.081	0.227	ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens OX=9606 GN=ULK3 PE=1 SV=2
18	P05986	1.38e-44	169	398	0.067	0.221	KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPK3 PE=1 SV=2
19	P06245	1.63e-44	168	380	0.070	0.242	KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPK2 PE=1 SV=2
20	P54644	1.73e-44	170	444	0.069	0.205	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.12	23.0	ABC1 atypical kinase-like domain
2	PF01636 APH	21	16.4	Phosphotransferase enzyme family
3	PF00514 Arm	4.3e+02	12.4	Armadillo/beta-catenin-like repeat
4	PF12717 Cnd1	0.11	24.0	non-SMC mitotic condensation complex subunit 1
5	PF12330 Haspin_kinase	14	16.1	Haspin like kinase domain
6	PF02985 HEAT	9.9e-10	48.8	HEAT repeat
7	PF13646 HEAT_2	7e-07	40.9	HEAT repeats
8	PF13513 HEAT_EZ	0.00075	31.3	HEAT-like repeat
9	PF06293 Kdo	4.4e+02	11.7	Lipopolysaccharide kinase (Kdo/WaaP) family
10	PF14531 Kinase-like	0.12	23.3	Kinase-like
11	PF00069 Pkinase	1e-71	253.0	Protein kinase domain
12	PF17667 Pkinase_fungal	11	16.3	Fungal protein kinase
13	PF07714 PK_Tyr_Ser-Thr	5.1e-38	142.4	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358918	0.999	Suppressor of fused homolog
2	9606.ENSP00000228682	0.996	Zinc finger protein GLI1
3	9606.ENSP00000390436	0.992	Zinc finger protein GLI2
4	9606.ENSP00000379258	0.962	Transcriptional activator GLI3
5	9606.ENSP00000249373	0.959	Smoothened homolog
6	9606.ENSP00000297814	0.790	Kinesin-like protein KIF27
7	9606.ENSP00000337946	0.741	Parkin coregulated gene protein
8	9606.ENSP00000398798	0.722	Zinc finger protein 142
9	9606.ENSP00000363270	0.699	RUN and FYVE domain containing 4
10	9606.ENSP00000265563	0.696	cAMP-dependent protein kinase type II-alpha regulatory subunit
11	9606.ENSP00000265717	0.696	cAMP-dependent protein kinase type II-beta regulatory subunit
12	9606.ENSP00000261778	0.685	Transport and golgi organization 6 homolog
13	9606.ENSP00000304250	0.674	Cyclin-dependent kinase 5 activator 2
14	9606.ENSP00000184956	0.673	HEAT repeat-containing protein 6
15	9606.ENSP00000216036	0.664	Radial spoke head 14 homolog
16	9606.ENSP00000361266	0.659	Protein patched homolog 2
17	9606.ENSP00000332353	0.657	Protein patched homolog 1
18	9606.ENSP00000297440	0.655	Dynein assembly factor 5, axonemal
19	9606.ENSP00000381198	0.653	LisH domain and HEAT repeat-containing protein KIAA1468
20	9606.ENSP00000434466	0.647	Integrator complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004674	0.997	protein serine/threonine kinase activity
GO:0019899	0.441	enzyme binding
GO:0097159	0.400	organic cyclic compound binding
GO:1901363	0.371	heterocyclic compound binding
GO:0001222	0.331	transcription corepressor binding
GO:0005524	0.320	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0030030	0.974	cell projection organization
GO:0007017	0.967	microtubule-based process
GO:0044782	0.953	cilium organization
GO:0070925	0.943	organelle assembly
GO:0007224	0.942	smoothened signaling pathway
GO:0060271	0.900	cilium assembly
GO:0019222	0.898	regulation of metabolic process
GO:0031323	0.885	regulation of cellular metabolic process
GO:0080090	0.793	regulation of primary metabolic process
GO:0009889	0.769	regulation of biosynthetic process
GO:0051171	0.761	regulation of nitrogen compound metabolic process
GO:0060255	0.752	regulation of macromolecule metabolic process
GO:0008152	0.614	metabolic process
GO:0010468	0.593	regulation of gene expression
GO:0065009	0.567	regulation of molecular function
GO:0032501	0.540	multicellular organismal process
GO:0032502	0.535	developmental process
GO:0010556	0.531	regulation of macromolecule biosynthetic process
GO:0031326	0.530	regulation of cellular biosynthetic process
GO:0006355	0.515	regulation of DNA-templated transcription
GO:0048856	0.510	anatomical structure development
GO:0071704	0.483	organic substance metabolic process
GO:0044238	0.461	primary metabolic process
GO:0048518	0.457	positive regulation of biological process
GO:0048522	0.442	positive regulation of cellular process
GO:0006807	0.431	nitrogen compound metabolic process
GO:0048583	0.380	regulation of response to stimulus
GO:0044237	0.379	cellular metabolic process
GO:0043170	0.344	macromolecule metabolic process
GO:0051090	0.336	regulation of DNA-binding transcription factor activity
GO:0036211	0.329	protein modification process
GO:0007275	0.319	multicellular organism development
GO:0009966	0.313	regulation of signal transduction
GO:0006796	0.312	phosphate-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.990	cytosol
GO:0043226	0.965	organelle
GO:0043229	0.961	intracellular organelle
GO:0043227	0.954	membrane-bounded organelle
GO:0005634	0.911	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.

[back to server]