StarFunc result for job id Q9NRR4

User Input

>input (1374 residues)
MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQYQYEPPSAPS
TTFSNSPAPNFLPPRPDFVPFPPPMPPSAQGPLPPCPIRPPFPNHQMRHPFPVPPCFPPM
PPPMPCPNNPPVPGAPPGQGTFPFMMPPPSMPHPPPPPVMPQQVNYQYPPGYSHHNFPPP
SFNSFQNNPSSFLPSANNSSSPHFRHLPPYPLPKAPSERRSPERLKHYDDHRHRDHSHGR
GERHRSLDRRERGRSPDRRRQDSRYRSDYDRGRTPSRHRSYERSRERERERHRHRDNRRS
PSLERSYKKEYKRSGRSYGLSVVPEPAGCTPELPGEIIKNTDSWAPPLEIVNHRSPSREK
KRARWEEEKDRWSDNQSSGKDKNYTSIKEKEPEETMPDKNEEEEEELLKPVWIRCTHSEN
YYSSDPMDQVGDSTVVGTSRLRDLYDKFEEELGSRQEKAKAARPPWEPPKTKLDEDLESS
SESECESDEDSTCSSSSDSEVFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSA
KARRTGIRHSIYPGEEAIKPCRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIEYDDHEYI
FEGFSMFAHAPLTNIPLCKVIRFNIDYTIHFIEEMMPENFCVKGLELFSLFLFRDILELY
DWNLKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMHQILLYLLRCSKALVPEEEIA
NMLQWEELEWQKYAEECKGMIVTNPGTKPSSVRIDQLDREQFNPDVITFPIIVHFGIRPA
QLSYAGDPQYQKLWKSYVKLRHLLANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTV
ELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQLAMTHP
SHHLNFGMNPDHARNSLSNCGIRQPKYGDRKVHHMHMRKKGINTLINIMSRLGQDDPTPS
RINHNERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDR
FMLYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWLN
YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL
GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA
ITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQDWND
PKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQA
EMGAAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRR4	1.000	1.000	0.000	1374	1.000	1.000	Q9NRR4.pdb.gz	RNC_HUMAN Ribonuclease 3 OS=Homo sapiens OX=9606 GN=DROSHA PE=1 SV=2
2	PDB:7yz4A	0.315	0.346	2.295E-18	1234	0.106	0.118	7yz4A.pdb.gz
3	PDB:8dgaA	0.348	0.298	1.218E-17	1629	0.119	0.101	8dgaA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
4	PDB:7yymA	0.312	0.332	2.744E-17	1281	0.106	0.114	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
5	PDB:8dg5A	0.335	0.288	1.111E-16	1635	0.119	0.100	8dg5A.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
6	PDB:7vg3A	0.340	0.517	1.909E-16	860	0.099	0.158	7vg3A.pdb.gz	Mechanism of siRNA production by a plant Dicer-RNA complex in dicing-competent conformation.
7	PDB:8dfvA	0.320	0.270	4.111E-16	1664	0.122	0.101	8dfvA.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
8	PDB:7w0dA	0.334	0.302	1.214E-15	1544	0.106	0.094	7w0dA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
9	PDB:7v6cA	0.308	0.279	2.086E-15	1540	0.108	0.096	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
10	PDB:7w0bA	0.307	0.271	2.861E-15	1586	0.106	0.091	7w0bA.pdb.gz	Structural insights into dsRNA processing by Drosophila Dicer-2-Loqs-PD.
11	PDB:7v6bA	0.305	0.283	7.379E-15	1496	0.109	0.100	7v6bA.pdb.gz
12	AFDB:Q8TB24	0.030	0.040	2.040E-1	985	0.071	0.098	Q8TB24.pdb.gz	RIN3_HUMAN Ras and Rab interactor 3 OS=Homo sapiens OX=9606 GN=RIN3 PE=1 SV=4
13	AFDB:Q9DB00	0.039	0.028	7.898E-1	2260	0.080	0.049	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
14	AFDB:A0A286YBL8	0.036	0.036	8.263E-1	1204	0.075	0.086	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
15	AFDB:A0A3B3IU55	0.026	0.034	9.897E-1	977	0.067	0.094	A0A3B3IU55.pdb.gz	A0A3B3IU55_HUMAN Stonin-2 OS=Homo sapiens OX=9606 GN=STON2 PE=1 SV=1
16	AFDB:Q62728	0.042	0.047	9.897E-1	1175	0.073	0.085	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
17	AFDB:E7FB74	0.042	0.061	1.035	765	0.064	0.115	E7FB74.pdb.gz	E7FB74_DANRE Ataxin-1-like OS=Danio rerio OX=7955 GN=atxn1l PE=3 SV=2
18	AFDB:Q2QXE3	0.044	0.057	1.035	881	0.074	0.115	Q2QXE3.pdb.gz	Q2QXE3_ORYSJ Expressed protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g06330 PE=4 SV=2
19	AFDB:B7Z0K1	0.053	0.061	1.701	1137	0.070	0.084	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
20	AFDB:Q8TC56	0.026	0.054	1.947	605	0.039	0.088	Q8TC56.pdb.gz	GAR3_HUMAN Golgi-associated RAB2 interactor protein 3 OS=Homo sapiens OX=9606 GN=GARIN3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RV16	0.0	1831	1289	0.682	0.727	A2RV16_DANRE Ribonuclease 3 OS=Danio rerio OX=7955 GN=zgc:158612 PE=1 SV=1
2	Q5HZJ0	0.0	2401	1373	0.956	0.957	RNC_MOUSE Ribonuclease 3 OS=Mus musculus OX=10090 GN=Drosha PE=1 SV=1
3	Q7KNF1	0.0	1036	1327	0.433	0.448	Q7KNF1_DROME Drosha OS=Drosophila melanogaster OX=7227 GN=drosha PE=2 SV=1
4	Q960Y4	0.0	1042	1071	0.389	0.499	Q960Y4_DROME LD29995p OS=Drosophila melanogaster OX=7227 GN=drosha PE=2 SV=1
5	Q9NRR4	0.0	2857	1374	1.000	1.000	RNC_HUMAN Ribonuclease 3 OS=Homo sapiens OX=9606 GN=DROSHA PE=1 SV=2
6	O01326	1.53e-171	543	1086	0.224	0.284	RNC_CAEEL Ribonuclease 3 OS=Caenorhabditis elegans OX=6239 GN=drsh-1 PE=2 SV=2
7	Q55FS1	5.72e-29	129	1385	0.060	0.059	Q55FS1_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=drnB PE=4 SV=2
8	A0A1D8PM62	1.22e-19	97.4	611	0.055	0.123	A0A1D8PM62_CANAL Ribonuclease III OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCR1 PE=3 SV=1
9	A7LFZ6	1.39e-19	98.2	1657	0.085	0.071	DCL4_ORYSJ Endoribonuclease Dicer homolog 4 OS=Oryza sativa subsp. japonica OX=39947 GN=DCL4 PE=2 SV=1
10	P0A7Y0	1.93e-19	90.9	226	0.042	0.257	RNC_ECOLI Ribonuclease 3 OS=Escherichia coli (strain K12) OX=83333 GN=rnc PE=1 SV=1
11	P84634	2.84e-18	94.0	1702	0.068	0.055	DCL4_ARATH Dicer-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=DCL4 PE=1 SV=2
12	Q9LXW7	3.68e-15	84.0	1580	0.068	0.059	DCL3_ARATH Endoribonuclease Dicer homolog 3 OS=Arabidopsis thaliana OX=3702 GN=DCL3 PE=1 SV=2
13	P22192	6.15e-14	77.4	363	0.042	0.160	PAC1_SCHPO Double-strand-specific pac1 ribonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pac1 PE=1 SV=1
14	Q6TV19	1.39e-13	78.6	1865	0.068	0.050	DICER_DANRE Endoribonuclease Dicer OS=Danio rerio OX=7955 GN=dicer1 PE=2 SV=2
15	Q09884	2.12e-11	71.2	1374	0.049	0.049	DCR1_SCHPO Protein Dicer OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dcr1 PE=1 SV=1
16	O67082	6.55e-11	65.9	221	0.043	0.267	RNC_AQUAE Ribonuclease 3 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=rnc PE=1 SV=1
17	Q9VCU9	1.26e-10	68.9	2249	0.070	0.043	DCR1_DROME Endoribonuclease Dcr-1 OS=Drosophila melanogaster OX=7227 GN=Dcr-1 PE=1 SV=1
18	Q8LMR2	4.90e-09	63.9	1883	0.077	0.056	DCL1_ORYSJ Endoribonuclease Dicer homolog 1 OS=Oryza sativa subsp. japonica OX=39947 GN=DCL1 PE=3 SV=1
19	Q9UPY3	5.63e-09	63.5	1922	0.055	0.039	DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1 PE=1 SV=3
20	E9PU15	6.89e-09	63.2	1918	0.049	0.035	E9PU15_RAT Endoribonuclease Dicer OS=Rattus norvegicus OX=10116 GN=Dicer1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00035 dsrm	4.5e-11	54.6	Double-stranded RNA binding motif
2	PF00636 Ribonuclease_3	3.1e-39	145.2	Ribonuclease III domain
3	PF14622 Ribonucleas_3_3	4.1e-40	148.3	Ribonuclease-III-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225792	0.999	Probable ATP-dependent RNA helicase DDX5
2	9606.ENSP00000263209	0.999	Microprocessor complex subunit DGCR8
3	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
4	9606.ENSP00000380033	0.999	Probable ATP-dependent RNA helicase DDX17
5	9606.ENSP00000254108	0.997	RNA-binding protein FUS
6	9606.ENSP00000381216	0.994	Far upstream element-binding protein 2
7	9606.ENSP00000220592	0.990	Protein argonaute-2
8	9606.ENSP00000405330	0.988	Estrogen receptor
9	9606.ENSP00000240185	0.983	TAR DNA-binding protein 43
10	9606.ENSP00000265351	0.977	Exportin-5
11	9606.ENSP00000296215	0.975	Smad nuclear-interacting protein 1
12	9606.ENSP00000362300	0.975	Protein argonaute-1
13	9606.ENSP00000266987	0.969	RISC-loading complex subunit TARBP2
14	9606.ENSP00000229307	0.966	Homeobox protein NANOG
15	9606.ENSP00000262160	0.959	Mothers against decapentaplegic homolog 2
16	9606.ENSP00000362306	0.958	Protein argonaute-4
17	9606.ENSP00000362287	0.949	Protein argonaute-3
18	9606.ENSP00000318176	0.947	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
19	9606.ENSP00000332973	0.941	Mothers against decapentaplegic homolog 3
20	9606.ENSP00000313829	0.936	KH domain-containing, RNA-binding, signal transduction-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004521	1.000	RNA endonuclease activity
GO:0016891	0.986	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0004525	0.930	ribonuclease III activity
GO:0070878	0.882	primary miRNA binding
GO:0042802	0.839	identical protein binding
GO:0019899	0.821	enzyme binding
GO:0046983	0.735	protein dimerization activity
GO:0046332	0.732	SMAD binding
GO:0001530	0.728	lipopolysaccharide binding
GO:0042803	0.727	protein homodimerization activity
GO:0017151	0.593	DEAD/H-box RNA helicase binding
GO:0070412	0.581	R-SMAD binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0050789	0.997	regulation of biological process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0034641	0.978	cellular nitrogen compound metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0048519	0.931	negative regulation of biological process
GO:0006139	0.927	nucleobase-containing compound metabolic process
GO:0010605	0.910	negative regulation of macromolecule metabolic process
GO:0006396	0.905	RNA processing
GO:0034660	0.767	ncRNA metabolic process
GO:0034470	0.761	ncRNA processing
GO:0010629	0.755	negative regulation of gene expression
GO:0050794	0.749	regulation of cellular process
GO:0031047	0.735	RNA-mediated gene silencing
GO:0070918	0.731	regulatory ncRNA processing
GO:0035196	0.720	miRNA processing
GO:0050896	0.656	response to stimulus
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0080090	0.466	regulation of primary metabolic process
GO:0031323	0.457	regulation of cellular metabolic process
GO:0048518	0.353	positive regulation of biological process
GO:0006950	0.334	response to stress
GO:0051252	0.329	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0005829	0.995	cytosol
GO:0043232	0.927	intracellular non-membrane-bounded organelle
GO:1902494	0.877	catalytic complex
GO:0140513	0.692	nuclear protein-containing complex
GO:0140535	0.691	intracellular protein-containing complex
GO:1905348	0.658	endonuclease complex
GO:1902555	0.571	endoribonuclease complex
GO:0030054	0.542	cell junction
GO:0045202	0.375	synapse
GO:0070877	0.366	microprocessor complex
GO:0016020	0.328	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.
EC:3.1.26.-	0.986	Endoribonucleases producing 5'-phosphomonoesters.
EC:3.1.26.3	0.930	ribonuclease III.

[back to server]