StarFunc result for job id Q9NRR5

User Input

>input (601 residues)
MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQ
PSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFME
LQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLN
NPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQ
FGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHP
TVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQ
TEAPGLVPSLGSFGISRTPAPSAGSNAGSTPEAPTSSPATPATSSPTGASSAQQQLMQQM
IQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQL
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRR5	0.999	0.999	7.844E-87	601	1.000	1.000	Q9NRR5.pdb.gz	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
2	AFDB:Q9UMX0	0.374	0.380	2.596E-52	589	0.624	0.637	Q9UMX0.pdb.gz	UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2
3	AFDB:Q9JJP9	0.356	0.365	5.076E-52	582	0.616	0.636	Q9JJP9.pdb.gz	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
4	AFDB:D4AA63	0.385	0.366	2.657E-49	638	0.606	0.571	D4AA63.pdb.gz	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
5	AFDB:Q9UHD9	0.364	0.352	3.108E-48	624	0.601	0.579	Q9UHD9.pdb.gz	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
6	AFDB:A0A024R258	0.245	0.259	5.262E-45	561	0.589	0.631	A0A024R258.pdb.gz
7	AFDB:Q9VWD9	0.238	0.258	4.073E-42	547	0.458	0.503	Q9VWD9.pdb.gz	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
8	AFDB:Q9H347	0.257	0.239	2.067E-31	655	0.409	0.376	Q9H347.pdb.gz	UBQL3_HUMAN Ubiquilin-3 OS=Homo sapiens OX=9606 GN=UBQLN3 PE=1 SV=2
9	AFDB:G5EFF7	0.223	0.253	7.822E-30	502	0.333	0.398	G5EFF7.pdb.gz	UBQL_CAEEL Ubiquilin OS=Caenorhabditis elegans OX=6239 GN=ubql-1 PE=2 SV=1
10	AFDB:Q9SII8	0.205	0.220	4.006E-25	551	0.333	0.363	Q9SII8.pdb.gz	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
11	PDB:7rbsB	0.123	0.455	5.119E-6	157	0.032	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
12	PDB:6yvaC	0.129	0.478	6.401E-6	155	0.028	0.110	6yvaC.pdb.gz
13	PDB:4pyuA	0.118	0.886	1.324E-5	76	0.025	0.197	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
14	PDB:5xqmA	0.119	0.703	1.324E-5	90	0.023	0.156	5xqmA.pdb.gz
15	PDB:3plvA	0.119	0.856	1.566E-5	80	0.035	0.263	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
16	PDB:6mdhA	0.118	0.464	1.751E-5	149	0.027	0.107	6mdhA.pdb.gz
17	PDB:3dbhI	0.129	0.820	3.062E-5	86	0.035	0.244	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:6ef3u	0.118	0.861	3.062E-5	75	0.038	0.307	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
19	PDB:3ai5A	0.122	0.242	3.621E-5	299	0.040	0.080	3ai5A.pdb.gz
20	PDB:3tixA	0.121	0.446	5.662E-5	153	0.020	0.078	3tixA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A287B231	0.0	585	561	0.577	0.619	A0A287B231_PIG Ubiquilin 1 OS=Sus scrofa OX=9823 GN=UBQLN1 PE=1 SV=2
2	Q8R317	0.0	652	582	0.609	0.629	UBQL1_MOUSE Ubiquilin-1 OS=Mus musculus OX=10090 GN=Ubqln1 PE=1 SV=1
3	Q99NB8	0.0	949	596	0.922	0.930	UBQL4_MOUSE Ubiquilin-4 OS=Mus musculus OX=10090 GN=Ubqln4 PE=1 SV=1
4	Q9JJP9	0.0	649	582	0.612	0.632	UBQL1_RAT Ubiquilin-1 OS=Rattus norvegicus OX=10116 GN=Ubqln1 PE=1 SV=1
5	Q9NRR5	0.0	1190	601	1.000	1.000	UBQL4_HUMAN Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2
6	Q9UHD9	0.0	560	624	0.576	0.554	UBQL2_HUMAN Ubiquilin-2 OS=Homo sapiens OX=9606 GN=UBQLN2 PE=1 SV=2
7	Q9UMX0	0.0	627	589	0.612	0.625	UBQL1_HUMAN Ubiquilin-1 OS=Homo sapiens OX=9606 GN=UBQLN1 PE=1 SV=2
8	D4AA63	8.41e-164	484	638	0.476	0.448	D4AA63_RAT Ubiquilin 2 OS=Rattus norvegicus OX=10116 GN=Ubqln2 PE=4 SV=1
9	Q9VWD9	1.47e-163	480	547	0.461	0.506	Q9VWD9_DROME LD38919p OS=Drosophila melanogaster OX=7227 GN=Ubqn PE=1 SV=1
10	Q9QZM0	1.73e-157	468	638	0.474	0.447	UBQL2_MOUSE Ubiquilin-2 OS=Mus musculus OX=10090 GN=Ubqln2 PE=1 SV=2
11	Q9H347	4.85e-92	299	655	0.285	0.261	UBQL3_HUMAN Ubiquilin-3 OS=Homo sapiens OX=9606 GN=UBQLN3 PE=1 SV=2
12	G5EFF7	5.06e-74	247	502	0.255	0.305	UBQL_CAEEL Ubiquilin OS=Caenorhabditis elegans OX=6239 GN=ubql-1 PE=2 SV=1
13	Q9SII9	7.62e-68	231	538	0.341	0.381	DSK2A_ARATH Ubiquitin domain-containing protein DSK2a OS=Arabidopsis thaliana OX=3702 GN=DSK2A PE=1 SV=2
14	Q9SII8	4.78e-58	206	551	0.281	0.307	DSK2B_ARATH Ubiquitin domain-containing protein DSK2b OS=Arabidopsis thaliana OX=3702 GN=DSK2B PE=1 SV=1
15	Q9D4I8	1.30e-45	171	510	0.300	0.353	Q9D4I8_MOUSE Ubiquilin 5 OS=Mus musculus OX=10090 GN=Ubqln5 PE=1 SV=1
16	Q8IYU4	2.81e-43	163	475	0.171	0.217	UBQLN_HUMAN Ubiquilin-like protein OS=Homo sapiens OX=9606 GN=UBQLNL PE=1 SV=3
17	Q9NIF3	4.63e-33	135	523	0.110	0.126	UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum OX=44689 GN=ubqln PE=1 SV=1
18	P48510	8.79e-15	78.6	373	0.123	0.198	DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSK2 PE=1 SV=2
19	Q10169	2.88e-08	58.5	354	0.115	0.195	DSK2_SCHPO Deubiquitination-protection protein dph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dph1 PE=4 SV=1
20	G1SU30	3.92e-05	49.3	1162	0.043	0.022	G1SU30_RABIT Large proline-rich protein BAG6 OS=Oryctolagus cuniculus OX=9986 GN=BAG6 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02845 CUE	1.8e+02	13.2	CUE domain
2	PF10302 Dsc3_N	1.4e+02	14.4	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
3	PF16678 HOIP-UBA	1.7e+02	13.5	HOIP UBA domain pair
4	PF15861 partial_CstF	2.7e+02	12.8	Partial cleavage stimulation factor domain
5	PF11976 Rad60-SLD	0.51	21.5	Ubiquitin-2 like Rad60 SUMO-like
6	PF13881 Rad60-SLD_2	66	15.0	Ubiquitin-2 like Rad60 SUMO-like
7	PF17830 STI1	8.3e-06	37.0	STI1 domain
8	PF00627 UBA	0.0037	28.4	UBA/TS-N domain
9	PF00240 ubiquitin	1e-11	55.7	Ubiquitin family
10	PF18036 Ubiquitin_4	8.9e+02	11.4	Ubiquitin-like domain
11	PF18037 Ubiquitin_5	0.83	21.3	Ubiquitin-like domain
12	PF08817 YukD	3.6	19.7	WXG100 protein secretion system (Wss), protein YukD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282561	0.995	Gap junction alpha-1 protein
2	9606.ENSP00000357879	0.995	26S proteasome non-ATPase regulatory subunit 4
3	9606.ENSP00000244769	0.950	Ataxin-1
4	9606.ENSP00000310129	0.926	26S proteasome non-ATPase regulatory subunit 2
5	9606.ENSP00000467024	0.914	UV excision repair protein RAD23 homolog A
6	9606.ENSP00000350708	0.892	UV excision repair protein RAD23 homolog B
7	9606.ENSP00000386541	0.867	26S proteasome non-ATPase regulatory subunit 14
8	9606.ENSP00000285667	0.823	Heat shock 70 kDa protein 13
9	9606.ENSP00000441543	0.822	Polyubiquitin-C
10	9606.ENSP00000365576	0.785	Ubiquilin-1
11	9606.ENSP00000387362	0.775	Ubiquitin conjugation factor E4 A
12	9606.ENSP00000343001	0.772	Ubiquitin conjugation factor E4 B
13	9606.ENSP00000396937	0.764	Proteasome 26S subunit, non-ATPase 13
14	9606.ENSP00000351777	0.750	Transitional endoplasmic reticulum ATPase
15	9606.ENSP00000391211	0.742	26S proteasome regulatory subunit 7
16	9606.ENSP00000188312	0.738	ARP6 actin related protein 6 homolog
17	9606.ENSP00000351646	0.731	Stress-induced-phosphoprotein 1
18	9606.ENSP00000360613	0.717	Ubiquitin-conjugating enzyme E2 A
19	9606.ENSP00000348838	0.712	Ubiquitin-conjugating enzyme E2 C
20	9606.ENSP00000310572	0.705	26S proteasome regulatory subunit 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.944	identical protein binding
GO:0031593	0.941	polyubiquitin modification-dependent protein binding
GO:0036435	0.686	K48-linked polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048583	0.968	regulation of response to stimulus
GO:0048519	0.952	negative regulation of biological process
GO:0048523	0.936	negative regulation of cellular process
GO:0071704	0.920	organic substance metabolic process
GO:0044237	0.914	cellular metabolic process
GO:0044238	0.913	primary metabolic process
GO:0050896	0.911	response to stimulus
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0080090	0.898	regulation of primary metabolic process
GO:0031323	0.895	regulation of cellular metabolic process
GO:0006807	0.893	nitrogen compound metabolic process
GO:0051716	0.875	cellular response to stimulus
GO:0032434	0.872	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043170	0.869	macromolecule metabolic process
GO:0080134	0.859	regulation of response to stress
GO:0019219	0.859	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.854	positive regulation of biological process
GO:1901564	0.846	organonitrogen compound metabolic process
GO:0006950	0.820	response to stress
GO:0051129	0.818	negative regulation of cellular component organization
GO:0033554	0.791	cellular response to stress
GO:2001020	0.774	regulation of response to DNA damage stimulus
GO:0031324	0.766	negative regulation of cellular metabolic process
GO:0019538	0.763	protein metabolic process
GO:0051172	0.761	negative regulation of nitrogen compound metabolic process
GO:0010605	0.755	negative regulation of macromolecule metabolic process
GO:0006282	0.727	regulation of DNA repair
GO:0000018	0.716	regulation of DNA recombination
GO:0051053	0.705	negative regulation of DNA metabolic process
GO:0044260	0.697	cellular macromolecule metabolic process
GO:0045910	0.690	negative regulation of DNA recombination
GO:0009895	0.679	negative regulation of catabolic process
GO:2000779	0.676	regulation of double-strand break repair
GO:0016241	0.662	regulation of macroautophagy
GO:0048522	0.658	positive regulation of cellular process
GO:0010569	0.640	regulation of double-strand break repair via homologous recombination
GO:0033043	0.624	regulation of organelle organization
GO:2001021	0.601	negative regulation of response to DNA damage stimulus
GO:0031330	0.598	negative regulation of cellular catabolic process
GO:0043244	0.546	regulation of protein-containing complex disassembly
GO:0006508	0.346	proteolysis
GO:0009893	0.337	positive regulation of metabolic process
GO:0006511	0.328	ubiquitin-dependent protein catabolic process
GO:0071840	0.326	cellular component organization or biogenesis
GO:0010498	0.307	proteasomal protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.991	intracellular organelle lumen
GO:0031981	0.978	nuclear lumen
GO:0005654	0.965	nucleoplasm
GO:0016020	0.956	membrane
GO:0032991	0.937	protein-containing complex
GO:0005773	0.701	vacuole
GO:0012505	0.633	endomembrane system
GO:0043232	0.581	intracellular non-membrane-bounded organelle
GO:0005776	0.510	autophagosome
GO:0140535	0.450	intracellular protein-containing complex
GO:1902494	0.407	catalytic complex
GO:0031595	0.363	nuclear proteasome complex
GO:0090734	0.318	site of DNA damage
GO:0071944	0.314	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]