StarFunc result for job id Q9NRR6

User Input

>input (644 residues)
MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSG
EDPPARAAPIAPRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEG
PGAPAHSCSPPCLSTSLQEIPKSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAG
SSPRLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPR
SPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVA
LFVATWNMQGQKELPPSLDEFLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHY
VLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQIKTKGALGISFTFFGTSFLF
ITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNF
RLSGGRTVVDALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGK
DTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRD
NIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRR6	1.000	1.000	0.000	644	1.000	1.000	Q9NRR6.pdb.gz	INP5E_HUMAN Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Homo sapiens OX=9606 GN=INPP5E PE=1 SV=2
2	AFDB:Q9WVR1	0.600	0.596	7.968E-92	648	0.773	0.769	Q9WVR1.pdb.gz	INP5E_RAT Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Rattus norvegicus OX=10116 GN=Inpp5e PE=1 SV=3
3	AFDB:A0A0R4ISZ8	0.586	0.928	2.688E-66	403	0.429	0.685	A0A0R4ISZ8.pdb.gz
4	AFDB:Q9VTW2	0.544	0.471	2.499E-49	747	0.334	0.288	Q9VTW2.pdb.gz	INP5E_DROME Inositol polyphosphate 5-phosphatase E OS=Drosophila melanogaster OX=7227 GN=INPP5E PE=1 SV=1
5	AFDB:P59644	0.434	0.284	4.571E-26	1003	0.228	0.147	P59644.pdb.gz	PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus OX=10090 GN=Inpp5j PE=1 SV=2
6	AFDB:Q15735	0.424	0.276	6.108E-26	1006	0.244	0.156	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
7	PDB:2imqX	0.371	0.812	4.669E-23	280	0.126	0.289	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
8	AFDB:Q62910	0.411	0.172	1.632E-18	1574	0.157	0.064	Q62910.pdb.gz	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
9	PDB:4f1iA	0.264	0.474	6.205E-9	328	0.071	0.140	4f1iA.pdb.gz
10	PDB:2j63A	0.244	0.410	8.929E-8	333	0.059	0.114	2j63A.pdb.gz
11	PDB:7kiuA	0.242	0.507	1.126E-7	263	0.071	0.175	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
12	PDB:2a3zB	0.247	0.518	1.594E-7	260	0.065	0.162	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
13	PDB:1akoA	0.271	0.566	9.617E-7	268	0.068	0.164	1akoA.pdb.gz
14	PDB:7ax1A	0.258	0.309	2.893E-6	518	0.070	0.087	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
15	PDB:6o1kA	0.251	0.508	4.231E-4	262	0.054	0.134	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
16	PDB:4iu6A	0.079	0.138	9.285E-2	304	0.040	0.086	4iu6A.pdb.gz	Pyridinylquinazolines selectively inhibit human methionine aminopeptidase-1 in cells.
17	PDB:1ng9A	0.046	0.042	2.091E-1	794	0.022	0.018	1ng9A.pdb.gz	The alternating ATPase domains of MutS control DNA mismatch repair
18	AFDB:O74502	0.065	0.041	3.836E-1	1254	0.109	0.056	O74502.pdb.gz	MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msh6 PE=1 SV=1
19	AFDB:X2JGQ0	0.078	0.070	3.836E-1	755	0.089	0.075	X2JGQ0.pdb.gz	X2JGQ0_DROME PH-sensitive chloride channel 1, isoform U OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=2
20	AFDB:Q9HFF4	0.064	0.046	5.756E-1	1023	0.109	0.068	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JII1	0.0	973	647	0.773	0.770	INP5E_MOUSE Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Mus musculus OX=10090 GN=Inpp5e PE=1 SV=1
2	Q9NRR6	0.0	1298	644	1.000	1.000	INP5E_HUMAN Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Homo sapiens OX=9606 GN=INPP5E PE=1 SV=2
3	Q9WVR1	0.0	981	648	0.772	0.767	INP5E_RAT Phosphatidylinositol polyphosphate 5-phosphatase type IV OS=Rattus norvegicus OX=10116 GN=Inpp5e PE=1 SV=3
4	Q9VTW2	3.45e-102	329	747	0.262	0.226	INP5E_DROME Inositol polyphosphate 5-phosphatase E OS=Drosophila melanogaster OX=7227 GN=INPP5E PE=1 SV=1
5	P50942	1.85e-45	176	1183	0.165	0.090	INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP52 PE=1 SV=1
6	Q12271	3.49e-42	166	1107	0.155	0.090	INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP53 PE=1 SV=1
7	A0A1D8PIH6	1.14e-41	164	986	0.148	0.096	A0A1D8PIH6_CANAL phosphoinositide 5-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=INP51 PE=3 SV=1
8	O43001	2.95e-40	160	1076	0.186	0.112	SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=syj1 PE=1 SV=1
9	Q9USQ6	3.05e-40	160	889	0.169	0.123	SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=syj2 PE=2 SV=1
10	H0Y5Q9	7.99e-38	152	810	0.160	0.127	H0Y5Q9_HUMAN Inositol polyphosphate-5-phosphatase D (Fragment) OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=1
11	Q92835	1.80e-37	152	1189	0.160	0.087	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2
12	Q54W40	6.90e-37	150	940	0.157	0.107	Q54W40_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P1 PE=4 SV=1
13	D7PF45	9.31e-37	150	1260	0.160	0.082	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
14	O15357	1.06e-36	149	1258	0.160	0.082	SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2
15	O43426	1.57e-36	149	1573	0.161	0.066	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2
16	O15056	2.44e-36	149	1496	0.175	0.076	SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2 PE=1 SV=3
17	Q6P549	3.19e-36	148	1257	0.160	0.082	SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus OX=10090 GN=Inppl1 PE=1 SV=1
18	Q8CHC4	3.19e-36	148	1574	0.161	0.066	SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus OX=10090 GN=Synj1 PE=1 SV=3
19	Q9WVR3	3.31e-36	148	1257	0.160	0.082	SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Inppl1 PE=1 SV=1
20	Q62910	3.52e-36	148	1574	0.161	0.066	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	1.6e-08	46.0	Endonuclease/Exonuclease/phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360777

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373713	0.964	Phosphatidylinositide phosphatase SAC1
2	9606.ENSP00000074304	0.941	Type I inositol 3,4-bisphosphate 4-phosphatase
3	9606.ENSP00000425487	0.937	Type II inositol 3,4-bisphosphate 4-phosphatase
4	9606.ENSP00000287600	0.930	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta
5	9606.ENSP00000383089	0.927	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
6	9606.ENSP00000377769	0.926	ADP-ribosylation factor-like protein 13B
7	9606.ENSP00000361021	0.918	Phosphatase and tensin homolog
8	9606.ENSP00000373399	0.917	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
9	9606.ENSP00000265382	0.911	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
10	9606.ENSP00000357883	0.898	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
11	9606.ENSP00000466363	0.892	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
12	9606.ENSP00000360154	0.864	Inositol polyphosphate 5-phosphatase OCRL-1
13	9606.ENSP00000362115	0.859	Type II inositol 1,4,5-trisphosphate 5-phosphatase
14	9606.ENSP00000347792	0.856	Synaptojanin-2
15	9606.ENSP00000409667	0.848	Synaptojanin-1
16	9606.ENSP00000367747	0.833	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
17	9606.ENSP00000388631	0.833	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
18	9606.ENSP00000285419	0.830	Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase
19	9606.ENSP00000266505	0.829	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
20	9606.ENSP00000345988	0.826	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046030	1.000	inositol trisphosphate phosphatase activity
GO:0004439	1.000	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
GO:0004445	0.881	inositol-polyphosphate 5-phosphatase activity
GO:0005488	0.859	binding
GO:0005515	0.845	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006650	0.989	glycerophospholipid metabolic process
GO:0046488	0.972	phosphatidylinositol metabolic process
GO:0006661	0.909	phosphatidylinositol biosynthetic process
GO:0065007	0.875	biological regulation
GO:0050789	0.858	regulation of biological process
GO:0050794	0.849	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0120025	0.998	plasma membrane bounded cell projection
GO:0012505	0.991	endomembrane system
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0016020	0.982	membrane
GO:0031981	0.976	nuclear lumen
GO:0005654	0.923	nucleoplasm
GO:0099568	0.788	cytoplasmic region
GO:0005856	0.699	cytoskeleton
GO:0005794	0.682	Golgi apparatus
GO:0005929	0.657	cilium
GO:0031090	0.614	organelle membrane
GO:0030054	0.609	cell junction
GO:0070161	0.518	anchoring junction
GO:0030055	0.437	cell-substrate junction
GO:0005925	0.426	focal adhesion
GO:0071944	0.415	cell periphery
GO:0005886	0.407	plasma membrane
GO:0098588	0.351	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22764	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + phosphate
EC:3.1.3.36	1.000	phosphoinositide 5-phosphatase.
EC:3.1.3.56	0.881	inositol-polyphosphate 5-phosphatase.

[back to server]