StarFunc result for job id Q9NRW4

User Input

>input (184 residues)
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAF
LRRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99N11	0.991	0.991	1.925E-35	184	0.935	0.935	Q99N11.pdb.gz	DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus OX=10090 GN=Dusp22 PE=1 SV=1
2	AFDB:B4F7B7	0.900	0.706	2.308E-21	236	0.478	0.373	B4F7B7.pdb.gz	DUS15_RAT Dual specificity protein phosphatase 15 OS=Rattus norvegicus OX=10116 GN=Dusp15 PE=2 SV=1
3	AFDB:Q9H1R2	0.741	0.466	1.596E-17	295	0.451	0.281	Q9H1R2.pdb.gz	DUS15_HUMAN Dual specificity protein phosphatase 15 OS=Homo sapiens OX=9606 GN=DUSP15 PE=1 SV=4
4	AFDB:Q9ESS0	0.687	0.274	1.681E-13	483	0.283	0.108	Q9ESS0.pdb.gz	DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2
5	AFDB:O54838	0.706	0.343	1.785E-13	384	0.288	0.138	O54838.pdb.gz	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
6	AFDB:Q9VVW5	0.724	0.338	2.719E-13	411	0.310	0.139	Q9VVW5.pdb.gz	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2
7	AFDB:D3ZAQ8	0.696	0.677	7.560E-13	189	0.245	0.238	D3ZAQ8.pdb.gz	D3ZAQ8_RAT Dual specificity phosphatase 21 OS=Rattus norvegicus OX=10116 GN=Dusp21 PE=4 SV=1
8	AFDB:V6CIV8	0.721	0.355	8.029E-13	381	0.299	0.144	V6CIV8.pdb.gz	DUSL_CAEEL Dual specificity protein phosphatase lip-1 OS=Caenorhabditis elegans OX=6239 GN=lip-1 PE=1 SV=1
9	AFDB:Q556Y8	0.741	0.294	1.152E-12	476	0.288	0.111	Q556Y8.pdb.gz	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
10	AFDB:O46122	0.685	0.273	1.465E-12	476	0.299	0.116	O46122.pdb.gz	O46122_DROME Puckered protein OS=Drosophila melanogaster OX=7227 GN=puc PE=2 SV=1
11	PDB:2esbA	0.696	0.787	2.670E-12	162	0.255	0.290	2esbA.pdb.gz
12	PDB:6d66A	0.719	0.263	3.198E-12	517	0.255	0.091	6d66A.pdb.gz
13	PDB:3f81A	0.653	0.671	3.765E-11	179	0.293	0.302	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
14	PDB:2wgpA	0.698	0.762	5.737E-11	168	0.250	0.274	2wgpA.pdb.gz
15	PDB:5y15A	0.722	0.889	7.749E-11	148	0.228	0.284	5y15A.pdb.gz
16	PDB:5xjvB	0.692	0.741	6.360E-10	171	0.272	0.292	5xjvB.pdb.gz
17	PDB:2y96A	0.704	0.738	7.173E-10	175	0.288	0.303	2y96A.pdb.gz
18	PDB:2gwoC	0.654	0.690	1.093E-9	174	0.272	0.287	2gwoC.pdb.gz
19	PDB:2q05A	0.667	0.678	1.191E-7	181	0.217	0.221	2q05A.pdb.gz
20	PDB:4ercA	0.559	0.672	5.593E-6	150	0.190	0.233	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRW4	1.40e-139	388	184	1.000	1.000	DUS22_HUMAN Dual specificity protein phosphatase 22 OS=Homo sapiens OX=9606 GN=DUSP22 PE=1 SV=1
2	Q99N11	5.88e-133	371	184	0.935	0.935	DUS22_MOUSE Dual specificity protein phosphatase 22 OS=Mus musculus OX=10090 GN=Dusp22 PE=1 SV=1
3	Q8R4V2	6.64e-67	206	235	0.478	0.374	DUS15_MOUSE Dual specificity protein phosphatase 15 OS=Mus musculus OX=10090 GN=Dusp15 PE=1 SV=3
4	B4F7B7	1.25e-66	205	236	0.478	0.373	DUS15_RAT Dual specificity protein phosphatase 15 OS=Rattus norvegicus OX=10116 GN=Dusp15 PE=2 SV=1
5	Q9H1R2	1.69e-55	179	295	0.413	0.258	DUS15_HUMAN Dual specificity protein phosphatase 15 OS=Homo sapiens OX=9606 GN=DUSP15 PE=1 SV=4
6	Q9ZR37	6.15e-27	102	198	0.299	0.278	DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1
7	Q9M8K7	2.33e-26	100	167	0.293	0.323	DUS1B_ARATH Dual specificity protein phosphatase 1B OS=Arabidopsis thaliana OX=3702 GN=DSPTP1B PE=1 SV=1
8	A0A0B4LHX7	6.33e-25	101	369	0.266	0.133	A0A0B4LHX7_DROME Puckered, isoform B OS=Drosophila melanogaster OX=7227 GN=puc PE=4 SV=1
9	Q64346	8.63e-25	100	381	0.299	0.144	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
10	Q16828	8.99e-25	100	381	0.299	0.144	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
11	Q9DBB1	1.14e-24	100	381	0.299	0.144	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1
12	Q7T2L8	2.21e-24	99.8	382	0.304	0.147	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
13	Q8WUJ0	2.29e-24	97.1	223	0.299	0.247	STYX_HUMAN Serine/threonine/tyrosine-interacting protein OS=Homo sapiens OX=9606 GN=STYX PE=1 SV=1
14	Q9VHV8	2.41e-24	100	476	0.266	0.103	Q9VHV8_DROME Puckered, isoform A OS=Drosophila melanogaster OX=7227 GN=puc PE=1 SV=1
15	Q556Y8	2.85e-24	100	476	0.266	0.103	DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273199 PE=3 SV=1
16	Q60969	3.86e-24	96.3	223	0.293	0.242	STYX_MOUSE Serine/threonine/tyrosine-interacting protein OS=Mus musculus OX=10090 GN=Styx PE=1 SV=2
17	Q99956	5.10e-24	99.0	384	0.304	0.146	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
18	O46122	1.21e-23	98.6	476	0.261	0.101	O46122_DROME Puckered protein OS=Drosophila melanogaster OX=7227 GN=puc PE=2 SV=1
19	Q16829	2.51e-23	97.4	419	0.299	0.131	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
20	Q9VVW5	2.51e-23	97.4	411	0.310	0.139	DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster OX=7227 GN=Mkp3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	4.3e-30	115.7	Dual specificity phosphatase, catalytic domain
2	PF18601 EZH2_N	30	16.4	EZH2 N-terminal domain
3	PF04179 Init_tRNA_PT	16	17.2	Rit1 DUSP-like domain
4	PF14566 PTPlike_phytase	87	14.7	Inositol hexakisphosphate
5	PF00102 Y_phosphatase	0.45	21.6	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000018076

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000001092	0.692	A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. May play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1I [...]
2	9601.ENSPPYP00000018079	0.678	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.
3	9601.ENSPPYP00000020333	0.654	Uncharacterized protein
4	9601.ENSPPYP00000004308	0.646	Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Involved in stress response. Prevents tumorigenesis (By similarity)
5	9601.ENSPPYP00000018085	0.636	GDP-mannose 4,6-dehydratase
6	9601.ENSPPYP00000004969	0.635	Probable FAD-dependent oxidoreductase
7	9601.ENSPPYP00000008506	0.634	HYDIN, axonemal central pair apparatus protein
8	9601.ENSPPYP00000017358	0.634	Uncharacterized protein
9	9601.ENSPPYP00000002956	0.620	Probable oxidoreductase
10	9601.ENSPPYP00000019255	0.610	Family with sequence similarity 120B
11	9601.ENSPPYP00000009121	0.609	Era-like 12S mitochondrial rRNA chaperone 1
12	9601.ENSPPYP00000011954	0.594	Cardiolipin synthase 1
13	9601.ENSPPYP00000012531	0.588	MRG/MORF4L binding protein
14	9601.ENSPPYP00000003312	0.580	Uncharacterized protein
15	9601.ENSPPYP00000004689	0.554	Probable RNA-binding protein EIF1AD
16	9601.ENSPPYP00000017359	0.548	NLR family, apoptosis inhibitory protein
17	9601.ENSPPYP00000018050	0.543	Mitogen-activated protein kinase 9
18	9601.ENSPPYP00000010161	0.540	Rho-associated, coiled-coil containing protein kinase 1
19	9601.ENSPPYP00000019006	0.539	Heat shock transcription factor 2
20	9601.ENSPPYP00000015262	0.536	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990782	1.000	protein tyrosine kinase binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0008138	0.939	protein tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.986	response to stimulus
GO:0030155	0.986	regulation of cell adhesion
GO:0071363	0.981	cellular response to growth factor stimulus
GO:0007162	0.981	negative regulation of cell adhesion
GO:0006796	0.973	phosphate-containing compound metabolic process
GO:0071704	0.958	organic substance metabolic process
GO:0044238	0.949	primary metabolic process
GO:0006807	0.947	nitrogen compound metabolic process
GO:1901564	0.944	organonitrogen compound metabolic process
GO:0043170	0.943	macromolecule metabolic process
GO:0019538	0.866	protein metabolic process
GO:0042326	0.859	negative regulation of phosphorylation
GO:0036211	0.851	protein modification process
GO:0001933	0.831	negative regulation of protein phosphorylation
GO:0150116	0.817	regulation of cell-substrate junction organization
GO:0035335	0.812	peptidyl-tyrosine dephosphorylation
GO:0070849	0.805	response to epidermal growth factor
GO:0048518	0.804	positive regulation of biological process
GO:0040012	0.757	regulation of locomotion
GO:0048522	0.757	positive regulation of cellular process
GO:0048583	0.756	regulation of response to stimulus
GO:0044087	0.741	regulation of cellular component biogenesis
GO:0051716	0.729	cellular response to stimulus
GO:0001952	0.726	regulation of cell-matrix adhesion
GO:1901888	0.718	regulation of cell junction assembly
GO:0090109	0.692	regulation of cell-substrate junction assembly
GO:0051893	0.678	regulation of focal adhesion assembly
GO:0007165	0.656	signal transduction
GO:0071364	0.613	cellular response to epidermal growth factor stimulus
GO:0009889	0.564	regulation of biosynthetic process
GO:0019219	0.505	regulation of nucleobase-containing compound metabolic process
GO:2000145	0.503	regulation of cell motility
GO:0010468	0.477	regulation of gene expression
GO:0065009	0.456	regulation of molecular function
GO:0010556	0.448	regulation of macromolecule biosynthetic process
GO:0007166	0.426	cell surface receptor signaling pathway
GO:0023051	0.396	regulation of signaling
GO:0010646	0.396	regulation of cell communication
GO:0033673	0.387	negative regulation of kinase activity
GO:0031326	0.374	regulation of cellular biosynthetic process
GO:0006469	0.374	negative regulation of protein kinase activity
GO:0042221	0.345	response to chemical
GO:0007167	0.334	enzyme-linked receptor protein signaling pathway
GO:2001141	0.306	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0005886	0.991	plasma membrane
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0032991	0.940	protein-containing complex
GO:0042995	0.933	cell projection
GO:0120025	0.914	plasma membrane bounded cell projection
GO:0043227	0.841	membrane-bounded organelle
GO:0043231	0.706	intracellular membrane-bounded organelle
GO:0005856	0.686	cytoskeleton
GO:0005634	0.660	nucleus
GO:0031252	0.637	cell leading edge
GO:0099081	0.628	supramolecular polymer
GO:0015629	0.602	actin cytoskeleton
GO:0099512	0.591	supramolecular fiber
GO:0099513	0.391	polymeric cytoskeletal fiber
GO:0005884	0.365	actin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]