StarFunc result for job id Q9NRX3

User Input

>input (87 residues)
MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWN
RLSPNDQYKFLAVSTDYKKLKKDRPDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RZD6	0.873	0.924	1.119E-8	82	0.540	0.573	B2RZD6.pdb.gz
2	AFDB:O00483	0.831	0.888	2.251E-8	81	0.575	0.617	O00483.pdb.gz	NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1
3	AFDB:Q9C002	0.606	0.629	1.023E-2	83	0.218	0.229	Q9C002.pdb.gz	NMES1_HUMAN Normal mucosa of esophagus-specific gene 1 protein OS=Homo sapiens OX=9606 GN=NMES1 PE=1 SV=1
4	AFDB:Q810Q5	0.542	0.563	1.702E-2	83	0.218	0.229	Q810Q5.pdb.gz	NMES1_MOUSE Normal mucosa of esophagus-specific gene 1 protein OS=Mus musculus OX=10090 GN=Nmes1 PE=1 SV=1
5	AFDB:Q42338	0.389	0.385	7.591	88	0.103	0.102	Q42338.pdb.gz	Q42338_ARATH AT3G48140 protein OS=Arabidopsis thaliana OX=3702 GN=T24C20_20 PE=1 SV=1
6	AFDB:Q8IL73	0.435	0.231	9.788	180	0.115	0.056	Q8IL73.pdb.gz	Q8IL73_PLAF7 Cytochrome c oxidase subunit ApiCOX26, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1439600 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00483	4.61e-32	108	81	0.575	0.617	NDUA4_HUMAN Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1
2	Q62425	1.91e-31	107	82	0.540	0.573	NDUA4_MOUSE Cytochrome c oxidase subunit NDUFA4 OS=Mus musculus OX=10090 GN=Ndufa4 PE=1 SV=2
3	F7FN80	2.17e-27	96.7	74	0.494	0.581	F7FN80_RAT NDUFA4, mitochondrial complex associated OS=Rattus norvegicus OX=10116 GN=Ndufa4 PE=1 SV=1
4	A0A8I6AXF3	1.11e-21	82.4	80	0.414	0.450	A0A8I6AXF3_RAT NDUFA4, mitochondrial complex associated OS=Rattus norvegicus OX=10116 GN=Ndufa4 PE=1 SV=1
5	Q9C002	5.06e-07	45.1	83	0.218	0.229	NMES1_HUMAN Normal mucosa of esophagus-specific gene 1 protein OS=Homo sapiens OX=9606 GN=NMES1 PE=1 SV=1
6	Q810Q5	7.55e-07	44.7	83	0.264	0.277	NMES1_MOUSE Normal mucosa of esophagus-specific gene 1 protein OS=Mus musculus OX=10090 GN=Nmes1 PE=1 SV=1
7	Q6IBW4	1.2	29.6	605	0.241	0.035	CNDH2_HUMAN Condensin-2 complex subunit H2 OS=Homo sapiens OX=9606 GN=NCAPH2 PE=1 SV=1
8	A0A0A6YYG7	1.3	29.6	589	0.241	0.036	A0A0A6YYG7_HUMAN Condensin-2 complex subunit H2 OS=Homo sapiens OX=9606 GN=NCAPH2 PE=1 SV=1
9	P00915	4.1	28.1	261	0.126	0.042	CAH1_HUMAN Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2
10	Q5XFW6	4.6	28.1	1125	0.172	0.013	WDR6_RAT tRNA (34-2'-O)-methyltransferase regulator WDR6 OS=Rattus norvegicus OX=10116 GN=Wdr6 PE=1 SV=2
11	O35182	4.7	27.7	495	0.138	0.024	SMAD6_MOUSE Mothers against decapentaplegic homolog 6 OS=Mus musculus OX=10090 GN=Smad6 PE=1 SV=1
12	Q9ZUB9	5.1	27.7	350	0.126	0.031	FB17_ARATH Putative F-box protein At1g23770 OS=Arabidopsis thaliana OX=3702 GN=At1g23770 PE=4 SV=1
13	Q9VBE5	8.7	27.3	1298	0.230	0.015	Q9VBE5_DROME MIP08606p OS=Drosophila melanogaster OX=7227 GN=plum PE=2 SV=2
14	Q9XU10	9.5	26.9	758	0.161	0.018	Q9XU10_CAEEL DNA mismatch repair protein S5 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlh-1 PE=1 SV=2
15	C3U1W5	9.6	26.9	431	0.126	0.026	C3U1W5_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=Smad6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06522 B12D	1e-23	94.2	NADH-ubiquinone reductase complex 1 MLRQ subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377411

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332887	0.831	Cytochrome b-c1 complex subunit 9
2	9606.ENSP00000365243	0.829	Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
3	9606.ENSP00000339720	0.805	Cytochrome c oxidase subunit NDUFA4
4	9606.ENSP00000306397	0.761	Cytochrome b-c1 complex subunit Rieske, mitochondrial
5	9606.ENSP00000457513	0.754	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
6	9606.ENSP00000309565	0.737	Cytochrome b-c1 complex subunit 6, mitochondrial
7	9606.ENSP00000246554	0.732	Cytochrome c oxidase subunit 6B1
8	9606.ENSP00000379784	0.719	Cytochrome c oxidase subunit 7B2, mitochondrial
9	9606.ENSP00000317780	0.708	Cytochrome c oxidase subunit 5A, mitochondrial
10	9606.ENSP00000485401	0.705	May be a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
11	9606.ENSP00000287490	0.696	Cytochrome c oxidase subunit 6A2, mitochondrial
12	9606.ENSP00000268379	0.689	Cytochrome b-c1 complex subunit 2, mitochondrial
13	9606.ENSP00000367939	0.671	Cytochrome b-c1 complex subunit 8
14	9606.ENSP00000261643	0.666	Protoheme IX farnesyltransferase, mitochondrial
15	9606.ENSP00000317159	0.666	Cytochrome c1, heme protein, mitochondrial
16	9606.ENSP00000417656	0.662	Cytochrome c oxidase subunit 7B, mitochondrial
17	9606.ENSP00000321260	0.647	Cytochrome c oxidase subunit 8A, mitochondrial
18	9606.ENSP00000430494	0.643	Cytochrome b-c1 complex subunit 7
19	9606.ENSP00000016171	0.640	Cytochrome c oxidase assembly protein COX15 homolog
20	9606.ENSP00000203407	0.638	Cytochrome b-c1 complex subunit 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022857	0.989	transmembrane transporter activity
GO:0009055	0.988	electron transfer activity
GO:0008137	0.970	NADH dehydrogenase (ubiquinone) activity
GO:0044877	0.863	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0050789	0.958	regulation of biological process
GO:0050794	0.945	regulation of cellular process
GO:0009987	0.847	cellular process
GO:0008152	0.639	metabolic process
GO:0071840	0.632	cellular component organization or biogenesis
GO:0016043	0.598	cellular component organization
GO:0044237	0.578	cellular metabolic process
GO:0043085	0.536	positive regulation of catalytic activity
GO:0019222	0.484	regulation of metabolic process
GO:0034762	0.463	regulation of transmembrane transport
GO:0031323	0.448	regulation of cellular metabolic process
GO:1904062	0.448	regulation of monoatomic cation transmembrane transport
GO:0043270	0.437	positive regulation of monoatomic ion transport
GO:0034764	0.437	positive regulation of transmembrane transport
GO:0032412	0.437	regulation of monoatomic ion transmembrane transporter activity
GO:0007005	0.421	mitochondrion organization
GO:0051341	0.394	regulation of oxidoreductase activity
GO:0043467	0.394	regulation of generation of precursor metabolites and energy
GO:0032411	0.387	positive regulation of transporter activity
GO:0032414	0.378	positive regulation of ion transmembrane transporter activity
GO:0022607	0.374	cellular component assembly
GO:0043933	0.306	protein-containing complex organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005751	0.999	mitochondrial respiratory chain complex IV
GO:0005747	0.999	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.990	Oxidoreductases.
RHEA:29091	0.970	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.970	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]