StarFunc result for job id Q9NRX4

User Input

>input (125 residues)
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKV
SGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTW
ANDGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRX4	1.000	1.000	6.556E-29	125	1.000	1.000	Q9NRX4.pdb.gz	PHP14_HUMAN 14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1
2	AFDB:P59083	0.933	0.926	9.193E-24	126	0.824	0.817	P59083.pdb.gz	PHP14_PIG 14 kDa phosphohistidine phosphatase OS=Sus scrofa OX=9823 GN=PHPT1 PE=1 SV=2
3	AFDB:Q9DAK9	0.940	0.948	2.332E-23	124	0.824	0.831	Q9DAK9.pdb.gz	PHP14_MOUSE 14 kDa phosphohistidine phosphatase OS=Mus musculus OX=10090 GN=Phpt1 PE=1 SV=1
4	PDB:2ai6A	0.886	0.886	3.679E-23	125	1.000	1.000	2ai6A.pdb.gz
5	AFDB:P20348	0.860	0.798	1.116E-15	135	0.376	0.348	P20348.pdb.gz	JANA_DROME Sex-regulated protein janus-A OS=Drosophila melanogaster OX=7227 GN=janA PE=2 SV=2
6	AFDB:P20349	0.816	0.732	3.529E-11	140	0.280	0.250	P20349.pdb.gz	JANB_DROME Sex-regulated protein janus-B OS=Drosophila melanogaster OX=7227 GN=janB PE=2 SV=1
7	AFDB:Q9Y170	0.803	0.685	2.005E-10	148	0.264	0.223	Q9Y170.pdb.gz	Q9Y170_DROME BcDNA.GH02250 OS=Drosophila melanogaster OX=7227 GN=ocn PE=2 SV=1
8	AFDB:A2THE9	0.338	0.054	2.736E-1	1098	0.072	0.008	A2THE9.pdb.gz	A2THE9_DANRE Telomerase reverse transcriptase OS=Danio rerio OX=7955 GN=TERT PE=2 SV=1
9	PDB:3vm8A	0.234	0.174	3.814E-1	187	0.056	0.037	3vm8A.pdb.gz	Crystal structure of the human APOBEC3C having HIV-1 Vif-binding interface
10	PDB:2beiB	0.264	0.222	4.888E-1	159	0.096	0.075	2beiB.pdb.gz	Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
11	PDB:2vzzA	0.177	0.125	7.092E-1	210	0.048	0.029	2vzzA.pdb.gz	Rv0802C from Mycobacterium Tuberculosis: The First Structure of a Succinyltransferase with the Gnat Fold.
12	AFDB:Q5ZUV9	0.249	0.078	7.385E-1	502	0.112	0.028	Q5ZUV9.pdb.gz	RAVZ_LEGPH Cysteine protease RavZ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=ravZ PE=1 SV=1
13	AFDB:Q09353	0.188	0.047	7.857E-1	697	0.072	0.013	Q09353.pdb.gz	SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans OX=6239 GN=ulp-1 PE=2 SV=3
14	PDB:2i2qA	0.192	0.194	8.029E-1	122	0.128	0.131	2i2qA.pdb.gz
15	AFDB:Q38CB3	0.178	0.029	9.465E-1	1165	0.072	0.008	Q38CB3.pdb.gz	Q38CB3_TRYB2 Mismatch repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6790 PE=4 SV=1
16	PDB:3owcA	0.155	0.147	9.672E-1	172	0.024	0.017	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
17	PDB:3fixA	0.206	0.164	1.095	165	0.088	0.067	3fixA.pdb.gz
18	PDB:2dptA	0.199	0.124	1.165	232	0.064	0.034	2dptA.pdb.gz	Crystal structures of leucyl/phenylalanyl-tRNA-protein transferase and its complex with an aminoacyl-tRNA analog
19	PDB:7v99A	0.373	0.061	1.319	991	0.048	0.006	7v99A.pdb.gz	Zipper head mechanism of telomere synthesis by human telomerase.
20	PDB:2mv2A	0.286	0.251	1.403	148	0.136	0.115	2mv2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRX4	1.03e-89	257	125	1.000	1.000	PHP14_HUMAN 14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=PHPT1 PE=1 SV=1
2	V9HWC4	1.03e-89	257	125	1.000	1.000	V9HWC4_HUMAN 14 kDa phosphohistidine phosphatase OS=Homo sapiens OX=9606 GN=HEL-S-132P PE=2 SV=1
3	P59083	9.35e-75	219	126	0.848	0.841	PHP14_PIG 14 kDa phosphohistidine phosphatase OS=Sus scrofa OX=9823 GN=PHPT1 PE=1 SV=2
4	Q9DAK9	2.90e-72	213	124	0.824	0.831	PHP14_MOUSE 14 kDa phosphohistidine phosphatase OS=Mus musculus OX=10090 GN=Phpt1 PE=1 SV=1
5	P20348	3.23e-25	94.7	135	0.400	0.370	JANA_DROME Sex-regulated protein janus-A OS=Drosophila melanogaster OX=7227 GN=janA PE=2 SV=2
6	P20349	3.51e-11	58.5	140	0.272	0.243	JANB_DROME Sex-regulated protein janus-B OS=Drosophila melanogaster OX=7227 GN=janB PE=2 SV=1
7	Q9Y170	3.01e-08	51.2	148	0.280	0.236	Q9Y170_DROME BcDNA.GH02250 OS=Drosophila melanogaster OX=7227 GN=ocn PE=2 SV=1
8	O35914	1.7	30.4	961	0.120	0.016	BNC1_MOUSE Zinc finger protein basonuclin-1 OS=Mus musculus OX=10090 GN=Bnc1 PE=1 SV=1
9	Q5ST81	4.5	28.9	372	0.104	0.035	Q5ST81_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=1
10	Q6VAF5	4.6	28.9	444	0.168	0.047	TBB7_GOSHI Tubulin beta-7 chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
11	G3V2A3	4.9	28.9	189	0.104	0.069	G3V2A3_HUMAN Tubulin beta chain (Fragment) OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=1
12	F5GY04	6.8	28.5	987	0.120	0.015	F5GY04_HUMAN Basonuclin 1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=1
13	Q01954	6.8	28.5	994	0.120	0.015	BNC1_HUMAN Zinc finger protein basonuclin-1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=2
14	P29515	7.4	28.5	449	0.152	0.042	TBB7_ARATH Tubulin beta-7 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB7 PE=2 SV=1
15	P29516	7.4	28.5	449	0.152	0.042	TBB8_ARATH Tubulin beta-8 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB8 PE=2 SV=2
16	B1PBV9	7.5	28.5	448	0.152	0.042	B1PBV9_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 GN=LOC107888744 PE=2 SV=1
17	B1PBV8	7.6	28.5	446	0.152	0.043	B1PBV8_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
18	P29517	7.6	28.5	444	0.152	0.043	TBB9_ARATH Tubulin beta-9 chain OS=Arabidopsis thaliana OX=3702 GN=TUBB9 PE=1 SV=1
19	Q4TZT6	7.6	28.5	445	0.152	0.043	Q4TZT6_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
20	B1PBW1	7.7	28.5	447	0.152	0.043	B1PBW1_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05005 Ocnus	1.7e-38	142.3	Janus/Ocnus family (Ocnus)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250495	0.952	NEDD8
2	9606.ENSP00000315774	0.863	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
3	9606.ENSP00000431482	0.863	NEDD8-MDP1 readthrough
4	9606.ENSP00000467262	0.862	Cytochrome b-c1 complex subunit 10
5	9606.ENSP00000363191	0.847	Reactive oxygen species modulator 1
6	9606.ENSP00000215565	0.835	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
7	9606.ENSP00000306003	0.834	ATP synthase subunit e, mitochondrial
8	9606.ENSP00000233627	0.831	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
9	9606.ENSP00000245816	0.825	ATP-dependent Clp protease proteolytic subunit, mitochondrial
10	9606.ENSP00000322450	0.817	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
11	9606.ENSP00000389160	0.817	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
12	9606.ENSP00000215375	0.806	ATP synthase subunit delta, mitochondrial
13	9606.ENSP00000466639	0.797	Uncharacterized protein
14	9606.ENSP00000367939	0.793	Cytochrome b-c1 complex subunit 8
15	9606.ENSP00000301457	0.787	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
16	9606.ENSP00000262888	0.771	Intermediate conductance calcium-activated potassium channel protein 4
17	9606.ENSP00000276062	0.765	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
18	9606.ENSP00000362873	0.761	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
19	9606.ENSP00000290079	0.760	Transmembrane protein 141
20	9606.ENSP00000357835	0.743	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0101006	0.944	protein histidine phosphatase activity
GO:0044325	0.862	transmembrane transporter binding
GO:0005246	0.856	calcium channel regulator activity
GO:0008200	0.856	ion channel inhibitor activity
GO:0019855	0.831	calcium channel inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.986	cellular metabolic process
GO:0065007	0.924	biological regulation
GO:0071704	0.921	organic substance metabolic process
GO:0044238	0.868	primary metabolic process
GO:0050789	0.867	regulation of biological process
GO:0050794	0.852	regulation of cellular process
GO:0006807	0.848	nitrogen compound metabolic process
GO:1901564	0.784	organonitrogen compound metabolic process
GO:0043170	0.777	macromolecule metabolic process
GO:0040012	0.568	regulation of locomotion
GO:0006793	0.568	phosphorus metabolic process
GO:0048518	0.525	positive regulation of biological process
GO:0048522	0.409	positive regulation of cellular process
GO:0019538	0.409	protein metabolic process
GO:0006796	0.328	phosphate-containing compound metabolic process
GO:0043412	0.326	macromolecule modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.998	intracellular organelle lumen
GO:0005654	0.992	nucleoplasm
GO:0016020	0.981	membrane
GO:0005886	0.883	plasma membrane
GO:0032991	0.566	protein-containing complex
GO:0016604	0.424	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:47964	0.944	H2O + N(pros)-phospho-L-histidyl-[protein] = L-histidyl-[protein] + phosphate
EC:3.9.1.3	0.944	phosphohistidine phosphatase.

[back to server]