StarFunc result for job id Q9NRY2

User Input

>input (104 residues)
MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAE
QQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRY2	1.000	1.000	5.891E-16	104	1.000	1.000	Q9NRY2.pdb.gz	SOSSC_HUMAN SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP PE=1 SV=1
2	PDB:4owtC	0.350	0.874	1.362E-4	39	0.365	0.974	4owtC.pdb.gz
3	PDB:7d4iRQ	0.200	0.076	3.175	339	0.115	0.035	7d4iRQ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
4	AFDB:Q6NWE4	0.255	0.095	3.443	357	0.144	0.042	Q6NWE4.pdb.gz
5	PDB:6zqdUN	0.234	0.127	4.224	203	0.135	0.069	6zqdUN.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
6	AFDB:Q9BSC4	0.306	0.056	4.580	688	0.135	0.020	Q9BSC4.pdb.gz	NOL10_HUMAN Nucleolar protein 10 OS=Homo sapiens OX=9606 GN=NOL10 PE=1 SV=1
7	PDB:7d5tRQ	0.200	0.076	5.231	339	0.106	0.032	7d5tRQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state F1)
8	PDB:6wkrC	0.175	0.047	5.618	606	0.125	0.021	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
9	AFDB:O74779	0.268	0.069	6.542	517	0.192	0.039	O74779.pdb.gz	MU164_SCHPO Microtubule-associated protein mug164 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug164 PE=1 SV=4
10	PDB:4xd9B	0.134	0.150	7.473	88	0.125	0.148	4xd9B.pdb.gz
11	PDB:6qp7A	0.121	0.027	8.618	620	0.087	0.015	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	AFDB:Q8I2Z8	0.260	0.030	8.702	1418	0.144	0.011	Q8I2Z8.pdb.gz	Q8I2Z8_PLAF7 Probable ATP-dependent 6-phosphofructokinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0915400 PE=3 SV=1
13	PDB:6yxxBW	0.249	0.146	9.940	188	0.144	0.080	6yxxBW.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRY2	1.34e-72	212	104	1.000	1.000	SOSSC_HUMAN SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP PE=1 SV=1
2	X6R8P6	1.64e-49	153	74	0.712	1.000	X6R8P6_HUMAN SOSS complex subunit C OS=Homo sapiens OX=9606 GN=INIP PE=1 SV=1
3	P30639	0.13	33.1	599	0.144	0.025	LNKN1_CAEEL Protein linkin OS=Caenorhabditis elegans OX=6239 GN=lnkn-1 PE=2 SV=1
4	L0H974	0.38	31.6	387	0.221	0.059	L0H974_SCHMD Mll1/2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1
5	Q8C9L6	2.0	29.6	795	0.135	0.018	Q8C9L6_MOUSE A-kinase anchor protein 2 OS=Mus musculus OX=10090 GN=Pakap PE=2 SV=1
6	A0A1D8PL65	2.8	29.3	741	0.144	0.020	A0A1D8PL65_CANAL Tok1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOK1 PE=3 SV=1
7	Q9FUZ2	3.7	28.5	273	0.221	0.084	DEF1B_ARATH Peptide deformylase 1B, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDF1B PE=1 SV=2
8	A8JNR2	5.3	28.5	629	0.183	0.030	A8JNR2_DROME Insulin receptor substrate 53 kDa, isoform D OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
9	A8JNR3	5.5	28.1	630	0.183	0.030	A8JNR3_DROME Insulin receptor substrate 53 kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
10	X2JCT5	5.8	28.1	646	0.183	0.029	X2JCT5_DROME Insulin receptor substrate 53 kDa, isoform E OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=1
11	A0A5F8MPZ6	6.0	28.1	336	0.125	0.039	A0A5F8MPZ6_MOUSE Paralemmin A kinase anchor protein (Fragment) OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
12	Q8IQE6	6.7	28.1	1076	0.183	0.018	Q8IQE6_DROME Insulin receptor substrate 53 kDa, isoform A OS=Drosophila melanogaster OX=7227 GN=IRSp53 PE=4 SV=2
13	O54931	8.0	27.7	893	0.125	0.015	AKAP2_MOUSE PALM2-AKAP2 fusion protein OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=4
14	Q99L95	8.1	27.7	799	0.125	0.016	Q99L95_MOUSE Akap2 protein OS=Mus musculus OX=10090 GN=Pakap PE=2 SV=1
15	Q5U301	8.2	27.7	870	0.125	0.015	AKAP2_RAT A-kinase anchor protein 2 OS=Rattus norvegicus OX=10116 GN=Akap2 PE=1 SV=1
16	F7AA26	8.4	27.7	1137	0.125	0.011	F7AA26_MOUSE Paralemmin A kinase anchor protein (Fragment) OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
17	A2API8	9.2	27.7	921	0.125	0.014	A2API8_MOUSE Paralemmin A kinase anchor protein OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
18	Q69ZV5	9.8	27.7	827	0.125	0.016	Q69ZV5_MOUSE MKIAA0920 protein (Fragment) OS=Mus musculus OX=10090 GN=Pakap PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13252 DUF4043	1.4e+02	12.7	Protein of unknown function (DUF4043)
2	PF11860 Muramidase	2.1e+02	13.5	N-acetylmuramidase
3	PF15925 SOSSC	5.4e-20	84.0	SOSS complex subunit C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020081

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012882	0.997	Integrator complex subunit 3
2	61853.ENSNLEP00000021275	0.997	Uncharacterized protein
3	61853.ENSNLEP00000008243	0.981	Nucleic acid binding protein 1
4	61853.ENSNLEP00000022671	0.698	Single-stranded DNA-binding protein
5	61853.ENSNLEP00000015973	0.691	Single-stranded DNA binding protein 2
6	61853.ENSNLEP00000010147	0.637	PRKR interacting protein 1 (IL11 inducible)
7	61853.ENSNLEP00000002638	0.566	Nibrin
8	61853.ENSNLEP00000008277	0.549	Retinoblastoma binding protein 8
9	61853.ENSNLEP00000021382	0.523	Cerberus 1, DAN family BMP antagonist

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006302	0.989	double-strand break repair
GO:1901987	0.988	regulation of cell cycle phase transition
GO:0007346	0.984	regulation of mitotic cell cycle
GO:1903047	0.980	mitotic cell cycle process
GO:0006310	0.980	DNA recombination
GO:0048523	0.978	negative regulation of cellular process
GO:0035556	0.978	intracellular signal transduction
GO:1902749	0.961	regulation of cell cycle G2/M phase transition
GO:1901991	0.961	negative regulation of mitotic cell cycle phase transition
GO:0000075	0.955	cell cycle checkpoint signaling
GO:0044818	0.951	mitotic G2/M transition checkpoint
GO:0010212	0.940	response to ionizing radiation
GO:0000725	0.912	recombinational repair
GO:0000724	0.816	double-strand break repair via homologous recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005694	0.985	chromosome
GO:0090734	0.966	site of DNA damage
GO:0140513	0.949	nuclear protein-containing complex
GO:0035861	0.929	site of double-strand break
GO:0005737	0.889	cytoplasm
GO:0070876	0.511	SOSS complex
GO:0005829	0.472	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]