StarFunc result for job id Q9NRY4

User Input

>input (1499 residues)
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEIDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL
EKLRNERKRVEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGND
GLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD
GFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMDT
SSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYKG
DNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGA
MKSFFSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLN
KVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP
ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81128	0.573	0.573	0.000	1499	0.977	0.977	P81128.pdb.gz	RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus OX=10116 GN=Arhgap35 PE=1 SV=3
2	AFDB:P97393	0.437	0.437	0.000	1501	0.499	0.498	P97393.pdb.gz	RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus OX=10090 GN=Arhgap5 PE=1 SV=3
3	AFDB:Q9VX32	0.512	0.494	2.586E-100	1561	0.300	0.288	Q9VX32.pdb.gz	RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster OX=7227 GN=RhoGAPp190 PE=1 SV=2
4	PDB:3cxlA	0.125	0.455	8.108E-13	402	0.047	0.174	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
5	PDB:6r3vA	0.124	0.878	1.633E-12	198	0.037	0.278	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
6	PDB:1xa6A	0.126	0.462	1.805E-12	399	0.047	0.178	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
7	AFDB:E7F3F0	0.130	0.086	2.749E-11	2286	0.121	0.079	E7F3F0.pdb.gz	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
8	PDB:5jcpA	0.114	0.460	1.266E-10	361	0.031	0.127	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
9	PDB:5c2kA	0.119	0.442	1.986E-10	382	0.049	0.191	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
10	AFDB:Q8CGF1	0.124	0.147	2.737E-9	1266	0.106	0.126	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
11	PDB:5sziA	0.097	0.734	9.778E-7	174	0.028	0.241	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
12	PDB:5szjA	0.097	0.707	3.089E-6	175	0.028	0.240	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:1zbdA	0.098	0.723	3.247E-6	177	0.028	0.237	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
14	AFDB:D4A9G6	0.124	0.142	5.478E-6	1310	0.049	0.056	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
15	PDB:5szhB	0.099	0.736	6.221E-6	175	0.024	0.206	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
16	PDB:1vg8A	0.096	0.664	6.540E-6	184	0.027	0.223	1vg8A.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
17	AFDB:Q54DW4	0.130	0.144	7.394E-6	1350	0.044	0.049	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
18	AFDB:A0A140LH27	0.120	0.108	7.004E-4	1664	0.039	0.035	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
19	AFDB:Q948L2	0.080	0.156	1.339E-2	686	0.057	0.125	Q948L2.pdb.gz	Q948L2_MAIZE Two-component response regulator OS=Zea mays OX=4577 GN=ZmRR10 PE=2 SV=1
20	AFDB:Q498G2	0.035	0.033	1.719E-2	1663	0.099	0.089	Q498G2.pdb.gz	CE152_XENLA Centrosomal protein of 152 kDa OS=Xenopus laevis OX=8355 GN=cep152 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K7N9	0.0	1459	1502	0.502	0.501	A0A0G2K7N9_RAT Rho GTPase activating protein 5 OS=Rattus norvegicus OX=10116 GN=Arhgap5 PE=1 SV=2
2	P81128	0.0	3055	1499	0.977	0.977	RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus OX=10116 GN=Arhgap35 PE=1 SV=3
3	P97393	0.0	1451	1503	0.503	0.502	RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus OX=10090 GN=Arhgap5 PE=1 SV=3
4	Q13017	0.0	1437	1502	0.504	0.503	RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5 PE=1 SV=2
5	Q6TUE6	0.0	1184	1245	0.414	0.499	Q6TUE6_RAT LRRGT00098 OS=Rattus norvegicus OX=10116 GN=Arhgap5 PE=1 SV=1
6	Q91YM2	0.0	3049	1499	0.978	0.978	RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus OX=10090 GN=Arhgap35 PE=1 SV=3
7	Q9NRY4	0.0	3114	1499	1.000	1.000	RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3
8	Q9VX32	0.0	587	1561	0.223	0.214	RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster OX=7227 GN=RhoGAPp190 PE=1 SV=2
9	Q7ZUT6	6.64e-33	136	459	0.048	0.157	Q7ZUT6_DANRE Chimerin (Chimaerin) 1 OS=Danio rerio OX=7955 GN=chimaerin PE=1 SV=1
10	Q03070	1.39e-32	131	295	0.047	0.241	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
11	P30337	1.67e-31	129	334	0.047	0.210	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
12	Q6ZUM4	2.25e-31	136	889	0.054	0.091	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
13	Q6TLK4	5.29e-31	134	869	0.048	0.083	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
14	P15882	1.73e-30	129	459	0.047	0.155	CHIN_HUMAN N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1 PE=1 SV=3
15	Q91V57	2.32e-30	129	459	0.047	0.153	CHIN_MOUSE N-chimaerin OS=Mus musculus OX=10090 GN=Chn1 PE=1 SV=2
16	P52757	3.93e-30	128	468	0.047	0.150	CHIO_HUMAN Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2
17	Q53QZ3	2.50e-28	122	475	0.047	0.149	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
18	Q1RLN5	2.82e-27	122	799	0.047	0.089	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
19	Q8IWW6	3.87e-27	122	846	0.047	0.084	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
20	J3JSM9	1.18e-25	118	1406	0.055	0.059	J3JSM9_HUMAN ARHGAP21 protein OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18196 Cdh1_DBD_1	57	15.4	Chromodomain helicase DNA-binding domain 1
2	PF01846 FF	9.5e-05	33.8	FF domain
3	PF07569 Hira	3.9e+02	12.1	TUP1-like enhancer of split
4	PF06858 NOG1	1.5e+02	13.5	Nucleolar GTP-binding protein 1 (NOG1)
5	PF00071 Ras	1.9e-07	42.3	Ras family
6	PF00620 RhoGAP	7.8e-46	167.1	RhoGAP domain
7	PF16512 RhoGAP-FF1	4.4e-24	96.2	p190-A and -B Rho GAPs FF domain
8	PF19518 RhoGAP_pG1_pG2	0	1205.7	p190RhoGAP, pG1 and pG2 domains

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385720

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274376	0.999	Ras GTPase-activating protein 1
2	9606.ENSP00000400175	0.999	Transforming protein RhoA
3	9606.ENSP00000346671	0.992	Tyrosine-protein kinase Fyn
4	9606.ENSP00000382004	0.992	Catenin delta-1
5	9606.ENSP00000364886	0.990	Rho-related GTP-binding protein RhoE
6	9606.ENSP00000362680	0.987	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000348461	0.968	Ras-related C3 botulinum toxin substrate 1
8	9606.ENSP00000272067	0.966	Low molecular weight phosphotyrosine protein phosphatase
9	9606.ENSP00000341189	0.961	Focal adhesion kinase 1
10	9606.ENSP00000308461	0.957	Rho-related GTP-binding protein Rho6
11	9606.ENSP00000340944	0.943	Tyrosine-protein phosphatase non-receptor type 11
12	9606.ENSP00000376345	0.938	Growth factor receptor-bound protein 2
13	9606.ENSP00000407586	0.937	GTPase HRas
14	9606.ENSP00000256078	0.933	GTPase KRas
15	9606.ENSP00000351209	0.932	Ephrin type-A receptor 2
16	9606.ENSP00000462468	0.923	Tyrosine-protein kinase Yes
17	9606.ENSP00000442460	0.921	Protein-tyrosine kinase 6
18	9606.ENSP00000337825	0.919	Tyrosine-protein kinase Lck
19	9606.ENSP00000357392	0.914	Ephrin-A1
20	9606.ENSP00000358548	0.914	GTPase NRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.999	protein binding
GO:0044877	0.881	protein-containing complex binding
GO:0032794	0.803	GTPase activating protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051056	0.989	regulation of small GTPase mediated signal transduction
GO:0009987	0.914	cellular process
GO:0050896	0.873	response to stimulus
GO:0007154	0.813	cell communication
GO:0051716	0.812	cellular response to stimulus
GO:0007165	0.786	signal transduction
GO:0032502	0.736	developmental process
GO:0048518	0.656	positive regulation of biological process
GO:0048522	0.637	positive regulation of cellular process
GO:0044093	0.607	positive regulation of molecular function
GO:0050790	0.581	regulation of catalytic activity
GO:0032501	0.579	multicellular organismal process
GO:0071840	0.558	cellular component organization or biogenesis
GO:0016043	0.511	cellular component organization
GO:0048856	0.486	anatomical structure development
GO:0051336	0.479	regulation of hydrolase activity
GO:0051128	0.455	regulation of cellular component organization
GO:0048519	0.443	negative regulation of biological process
GO:0048523	0.425	negative regulation of cellular process
GO:0007275	0.368	multicellular organism development
GO:0043087	0.336	regulation of GTPase activity
GO:0043085	0.307	positive regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.970	organelle
GO:0043229	0.955	intracellular organelle
GO:0043227	0.950	membrane-bounded organelle
GO:0043231	0.772	intracellular membrane-bounded organelle
GO:0043232	0.707	intracellular non-membrane-bounded organelle
GO:0016020	0.687	membrane
GO:0071944	0.488	cell periphery
GO:0005886	0.479	plasma membrane
GO:0031981	0.347	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]