StarFunc result for job id Q9NRZ5

User Input

>input (378 residues)
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQ
LVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKV
LAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRF
TEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTL
LGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV
PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTE
IDKGSAYGNSDSKQKLND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRZ5	1.000	1.000	2.635E-68	378	1.000	1.000	Q9NRZ5.pdb.gz	PLCD_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens OX=9606 GN=AGPAT4 PE=1 SV=1
2	AFDB:Q8K4X7	0.975	0.975	1.091E-60	378	0.857	0.857	Q8K4X7.pdb.gz	PLCD_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Mus musculus OX=10090 GN=Agpat4 PE=1 SV=1
3	AFDB:Q9D517	0.970	0.975	2.057E-50	376	0.608	0.612	Q9D517.pdb.gz	PLCC_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Mus musculus OX=10090 GN=Agpat3 PE=1 SV=2
4	AFDB:D5AEK7	0.949	0.904	2.003E-35	397	0.376	0.358	D5AEK7.pdb.gz	D5AEK7_DROME 1-Acylglycerol-3-phosphate O-acyltransferase 3, isoform E OS=Drosophila melanogaster OX=7227 GN=Agpat3 PE=1 SV=1
5	AFDB:Q9SYC8	0.913	0.918	8.129E-34	376	0.310	0.311	Q9SYC8.pdb.gz	LPAT3_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=LPAT3 PE=2 SV=1
6	AFDB:Q8LG50	0.907	0.882	3.473E-32	389	0.288	0.280	Q8LG50.pdb.gz	LPAT2_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=LPAT2 PE=1 SV=2
7	AFDB:Q20800	0.748	0.724	2.136E-21	391	0.243	0.235	Q20800.pdb.gz	LPIAT_CAEEL Lysophosphatidylinositol acyltransferase 10 OS=Caenorhabditis elegans OX=6239 GN=bus-18 PE=1 SV=2
8	AFDB:Q6UWP7	0.685	0.631	1.361E-20	414	0.254	0.232	Q6UWP7.pdb.gz	LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens OX=9606 GN=LCLAT1 PE=1 SV=1
9	AFDB:O94361	0.700	0.752	2.162E-20	350	0.222	0.240	O94361.pdb.gz	YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC428.14 PE=3 SV=1
10	AFDB:Q3UN02	0.682	0.685	2.944E-20	376	0.254	0.255	Q3UN02.pdb.gz	LCLT1_MOUSE Lysocardiolipin acyltransferase 1 OS=Mus musculus OX=10090 GN=Lclat1 PE=1 SV=2
11	PDB:5f2tB	0.322	0.431	3.457E-2	262	0.085	0.122	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:2ewvA	0.202	0.217	4.034E-2	343	0.061	0.067	2ewvA.pdb.gz	Crystal structures of the pilus retraction motor PilT suggest large domain movements and subunit cooperation drive motility.
13	PDB:4ihqA	0.186	0.151	7.479E-2	512	0.079	0.059	4ihqA.pdb.gz	Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
14	PDB:1nl3A	0.158	0.085	1.703E-1	839	0.090	0.041	1nl3A.pdb.gz
15	PDB:5gadi	0.148	0.130	2.570E-1	450	0.066	0.056	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
16	PDB:1pfkA	0.135	0.154	3.157E-1	320	0.077	0.091	1pfkA.pdb.gz	Crystal structure of the complex of phosphofructokinase from Escherichia coli with its reaction products.
17	PDB:2x9qA	0.145	0.200	3.324E-1	231	0.053	0.087	2x9qA.pdb.gz
18	PDB:2cdnA	0.156	0.266	3.499E-1	186	0.077	0.156	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
19	PDB:3jvvC	0.193	0.209	3.499E-1	337	0.066	0.074	3jvvC.pdb.gz	P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
20	PDB:6xlpA	0.213	0.154	3.499E-1	586	0.056	0.036	6xlpA.pdb.gz	Structure of the essential inner membrane lipopolysaccharide-PbgA complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K4X7	0.0	676	378	0.857	0.857	PLCD_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Mus musculus OX=10090 GN=Agpat4 PE=1 SV=1
2	Q9NRZ5	0.0	786	378	1.000	1.000	PLCD_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens OX=9606 GN=AGPAT4 PE=1 SV=1
3	Q9NRZ7	2.60e-177	499	376	0.614	0.617	PLCC_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Homo sapiens OX=9606 GN=AGPAT3 PE=1 SV=1
4	Q9D517	7.02e-173	488	376	0.608	0.612	PLCC_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Mus musculus OX=10090 GN=Agpat3 PE=1 SV=2
5	Q9VV51	6.51e-88	272	386	0.392	0.383	Q9VV51_DROME 1-Acylglycerol-3-phosphate O-acyltransferase 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Agpat3 PE=1 SV=1
6	D5AEK7	6.54e-88	273	397	0.394	0.375	D5AEK7_DROME 1-Acylglycerol-3-phosphate O-acyltransferase 3, isoform E OS=Drosophila melanogaster OX=7227 GN=Agpat3 PE=1 SV=1
7	Q9SYC8	7.05e-72	231	376	0.328	0.330	LPAT3_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana OX=3702 GN=LPAT3 PE=2 SV=1
8	Q8LG50	8.91e-62	205	389	0.278	0.270	LPAT2_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=LPAT2 PE=1 SV=2
9	O94361	6.16e-29	117	350	0.214	0.231	YHOE_SCHPO Uncharacterized acyltransferase C428.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC428.14 PE=3 SV=1
10	Q6UWP7	2.08e-24	105	414	0.198	0.181	LCLT1_HUMAN Lysocardiolipin acyltransferase 1 OS=Homo sapiens OX=9606 GN=LCLAT1 PE=1 SV=1
11	P38226	5.82e-24	103	397	0.209	0.199	CST26_YEAST 2-acyl-1-lysophosphatidylinositol acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CST26 PE=1 SV=1
12	Q3UN02	2.82e-23	102	376	0.217	0.218	LCLT1_MOUSE Lysocardiolipin acyltransferase 1 OS=Mus musculus OX=10090 GN=Lclat1 PE=1 SV=2
13	A0A024R640	4.78e-23	101	364	0.175	0.181	A0A024R640_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase 5 (Lysophosphatidic acid acyltransferase, epsilon), isoform CRA_a OS=Homo sapiens OX=9606 GN=AGPAT5 PE=2 SV=1
14	Q9NUQ2	4.78e-23	101	364	0.175	0.181	PLCE_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens OX=9606 GN=AGPAT5 PE=1 SV=3
15	Q9D1E8	1.20e-22	100	365	0.183	0.189	PLCE_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Mus musculus OX=10090 GN=Agpat5 PE=1 SV=2
16	Q6NYV8	7.67e-22	97.8	388	0.159	0.155	LCLT1_DANRE Lysocardiolipin acyltransferase 1 OS=Danio rerio OX=7955 GN=lclat1 PE=1 SV=1
17	Q12185	1.11e-21	97.8	396	0.230	0.220	YD018_YEAST Uncharacterized acyltransferase YDR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR018C PE=3 SV=1
18	Q20800	9.07e-18	86.3	391	0.214	0.207	LPIAT_CAEEL Lysophosphatidylinositol acyltransferase 10 OS=Caenorhabditis elegans OX=6239 GN=bus-18 PE=1 SV=2
19	Q961F9	2.23e-17	80.1	143	0.135	0.357	Q961F9_DROME 1-Acylglycerol-3-phosphate O-acyltransferase 3, isoform D OS=Drosophila melanogaster OX=7227 GN=Agpat3 PE=1 SV=1
20	Q582D7	4.76e-13	72.4	434	0.151	0.131	Q582D7_TRYB2 Acetyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.270 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	8.5e-12	56.3	Acyltransferase
2	PF16076 Acyltransf_C	9.1e-26	100.9	Acyltransferase C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380184	0.973	Glycerol-3-phosphate acyltransferase 4
2	9606.ENSP00000265276	0.969	Glycerol-3-phosphate acyltransferase 1, mitochondrial
3	9606.ENSP00000482571	0.964	Glycerol-3-phosphate acyltransferase 3
4	9606.ENSP00000360761	0.963	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
5	9606.ENSP00000389395	0.955	Glycerol-3-phosphate acyltransferase 2, mitochondrial
6	9606.ENSP00000378877	0.948	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
7	9606.ENSP00000302177	0.936	Lysophospholipid acyltransferase 2
8	9606.ENSP00000360296	0.935	Phospholipid phosphatase 3
9	9606.ENSP00000264775	0.932	Phospholipid phosphatase 1
10	9606.ENSP00000324944	0.927	Lysophospholipid acyltransferase 1
11	9606.ENSP00000329697	0.920	Phospholipid phosphatase 2
12	9606.ENSP00000295887	0.919	Phosphatidate cytidylyltransferase 1
13	9606.ENSP00000419879	0.916	Phosphatidate cytidylyltransferase 2
14	9606.ENSP00000352962	0.908	Lipid phosphate phosphatase-related protein type 3
15	9606.ENSP00000359204	0.908	Phospholipid phosphatase-related protein type 4
16	9606.ENSP00000381302	0.908	Phospholipid phosphatase 4
17	9606.ENSP00000466898	0.908	Lipid phosphate phosphatase-related protein type 2
18	9606.ENSP00000347581	0.905	Acylglycerol kinase, mitochondrial
19	9606.ENSP00000355607	0.860	Glyceronephosphate O-acyltransferase
20	9606.ENSP00000362354	0.859	Phosphatidate phosphatase LPIN3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003841	1.000	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046486	0.997	glycerolipid metabolic process
GO:0044249	0.995	cellular biosynthetic process
GO:0008610	0.995	lipid biosynthetic process
GO:0046473	0.992	phosphatidic acid metabolic process
GO:0046474	0.987	glycerophospholipid biosynthetic process
GO:0006654	0.967	phosphatidic acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.999	organelle membrane
GO:0031984	0.930	organelle subcompartment
GO:0042175	0.895	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.895	endoplasmic reticulum subcompartment
GO:0005789	0.894	endoplasmic reticulum membrane
GO:0098588	0.338	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19709	1.000	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	1.000	1-acylglycerol-3-phosphate O-acyltransferase.

[back to server]