StarFunc result for job id Q9NS15

User Input

>input (1303 residues)
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLLLLGLGGRVEGGPAGERGAGGGGALARE
RFKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNG
GQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRTGALSTGALPPLAPEGDSVA
SKHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPEASV
QVHRIESSNAESAAPSQHLLPHPKPSHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQ
EDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECA
MPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLT
TRLTRQLCCCSVGKAWGARCQRCPTDGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSL
FLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYP
ELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCH
CNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVD
LNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCEN
KPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDG
RSCLDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGGD
CINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTP
TQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCP
VYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECY
CKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEE
MDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWS
QRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTS
PLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRE
LNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS15	1.000	1.000	0.000	1303	1.000	1.000	Q9NS15.pdb.gz	LTBP3_HUMAN Latent-transforming growth factor beta-binding protein 3 OS=Homo sapiens OX=9606 GN=LTBP3 PE=1 SV=4
2	PDB:7q3nU	0.054	0.190	1.724E-7	292	0.041	0.182	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
3	PDB:2gsxA	0.062	0.075	2.499E-6	951	0.096	0.131	2gsxA.pdb.gz
4	AFDB:E9Q7X6	0.075	0.073	1.123E-5	1337	0.147	0.144	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
5	AFDB:Q9ULI3	0.063	0.060	2.737E-5	1381	0.138	0.130	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
6	AFDB:A1Z6W9	0.053	0.049	1.720E-4	1363	0.173	0.165	A1Z6W9.pdb.gz	A1Z6W9_DROME Pawn, isoform B OS=Drosophila melanogaster OX=7227 GN=pwn PE=4 SV=2
7	AFDB:P55066	0.065	0.067	1.510E-3	1268	0.127	0.130	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
8	PDB:7nycC	0.043	0.062	3.897E-3	809	0.043	0.069	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
9	AFDB:Q04164	0.046	0.040	4.116E-3	1693	0.124	0.096	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
10	AFDB:A0A2R8QK78	0.061	0.054	6.078E-3	1570	0.113	0.094	A0A2R8QK78.pdb.gz
11	AFDB:O23372	0.042	0.029	6.794E-3	2335	0.147	0.082	O23372.pdb.gz	ATXR3_ARATH Histone-lysine N-methyltransferase ATXR3 OS=Arabidopsis thaliana OX=3702 GN=ATXR3 PE=2 SV=2
12	PDB:3b4vD	0.044	0.209	1.327E-2	213	0.037	0.225	3b4vD.pdb.gz
13	PDB:7n9qA	0.051	0.039	1.658E-2	2315	0.051	0.029	7n9qA.pdb.gz
14	AFDB:B8A4S4	0.028	0.026	6.306E-2	1408	0.134	0.124	B8A4S4.pdb.gz	B8A4S4_DANRE Collagen, type XVII, alpha 1a OS=Danio rerio OX=7955 GN=si:ch211-281g13.3 PE=4 SV=1
15	AFDB:Q9VAW5	0.040	0.035	1.301E-1	1673	0.128	0.100	Q9VAW5.pdb.gz	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
16	PDB:3t5oA	0.031	0.039	1.819E-1	871	0.043	0.064	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:6pxvA	0.053	0.073	2.541E-1	823	0.026	0.041	6pxvA.pdb.gz
18	PDB:2qzvA	0.042	0.058	7.322E-1	749	0.040	0.069	2qzvA.pdb.gz
19	PDB:4bxsA	0.032	0.152	7.741E-1	248	0.012	0.065	4bxsA.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
20	PDB:4bxwB	0.024	0.093	9.149E-1	287	0.010	0.045	4bxwB.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7YY58	0.0	813	1338	0.404	0.394	A7YY58_BOVIN LTBP1 protein OS=Bos taurus OX=9913 GN=LTBP1 PE=2 SV=1
2	B7ZLY3	0.0	869	1353	0.414	0.399	B7ZLY3_HUMAN LTBP1 protein OS=Homo sapiens OX=9606 GN=LTBP1 PE=2 SV=1
3	F1MF86	0.0	646	1963	0.365	0.242	F1MF86_BOVIN Latent transforming growth factor beta binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=4 SV=1
4	O08999	0.0	633	1813	0.364	0.261	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
5	Q00918	0.0	864	1712	0.422	0.321	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
6	Q14766	0.0	844	1721	0.413	0.313	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
7	Q14767	0.0	644	1821	0.365	0.261	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
8	Q28019	0.0	646	1842	0.365	0.258	LTBP2_BOVIN Latent-transforming growth factor beta-binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=1 SV=2
9	Q61810	0.0	2212	1253	0.904	0.940	LTBP3_MOUSE Latent-transforming growth factor beta-binding protein 3 OS=Mus musculus OX=10090 GN=Ltbp3 PE=1 SV=4
10	Q8CG19	0.0	858	1712	0.421	0.321	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
11	Q9NS15	0.0	2615	1303	1.000	1.000	LTBP3_HUMAN Latent-transforming growth factor beta-binding protein 3 OS=Homo sapiens OX=9606 GN=LTBP3 PE=1 SV=4
12	Q8K4G1	2.81e-137	461	1666	0.335	0.262	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2
13	Q8N2S1	5.55e-130	440	1624	0.323	0.259	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
14	B6CS38	8.34e-116	403	2868	0.262	0.119	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1
15	A0A0G2KQ62	1.60e-115	402	2868	0.262	0.119	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
16	Q61555	5.69e-113	395	2907	0.262	0.117	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
17	P35556	5.92e-111	389	2912	0.259	0.116	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
18	A0A8I6G7Y9	3.57e-105	371	2861	0.266	0.121	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
19	P98133	1.64e-99	354	2871	0.264	0.120	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
20	Q61554	7.06e-99	352	2873	0.261	0.118	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.2e-61	215.4	Complement Clr-like EGF-like
2	PF00008 EGF	4.1e-23	92.6	EGF-like domain
3	PF12947 EGF_3	4.4e-21	86.1	EGF domain
4	PF07645 EGF_CA	6.7e-88	300.0	Calcium-binding EGF domain
5	PF14670 FXa_inhibition	4.3e-10	51.1	Coagulation Factor Xa inhibitory site
6	PF12661 hEGF	4.1e-18	76.5	Human growth factor-like EGF
7	PF06247 Plasmod_Pvs28	0.0033	29.0	Pvs28 EGF domain
8	PF00683 TB	9.3e-37	135.9	TB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221930	0.916	Transforming growth factor beta-1
2	9606.ENSP00000355896	0.900	Transforming growth factor beta-2
3	9606.ENSP00000238682	0.870	Transforming growth factor beta-3
4	9606.ENSP00000381782	0.715	Solute carrier family 25 member 45
5	9606.ENSP00000260950	0.714	Growth/differentiation factor 8
6	9606.ENSP00000307954	0.680	Membrane protein FAM174A
7	9606.ENSP00000319726	0.680	Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface . Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6
8	9606.ENSP00000290894	0.676	SH2 domain-containing adapter protein F
9	9606.ENSP00000432568	0.661	Spectrin beta chain, non-erythrocytic 2
10	9606.ENSP00000263373	0.658	Spectrin beta chain, non-erythrocytic 4
11	9606.ENSP00000166139	0.651	Follistatin-related protein 3
12	9606.ENSP00000393887	0.642	Alpha-2-HS-glycoprotein
13	9606.ENSP00000312671	0.635	EH domain-binding protein 1-like protein 1
14	9606.ENSP00000027335	0.627	Cadherin-17
15	9606.ENSP00000387050	0.627	Phospholipase D3
16	9606.ENSP00000263277	0.626	EH domain-containing protein 2
17	9606.ENSP00000484928	0.625	Cadherin-4
18	9606.ENSP00000269141	0.616	Cadherin-2
19	9606.ENSP00000355245	0.608	Paired box protein Pax-9
20	9606.ENSP00000375778	0.594	Laminin subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050431	1.000	transforming growth factor beta binding
GO:0005102	0.381	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0048856	0.986	anatomical structure development
GO:0050896	0.975	response to stimulus
GO:0032501	0.969	multicellular organismal process
GO:0007275	0.964	multicellular organism development
GO:0070848	0.951	response to growth factor
GO:0048513	0.935	animal organ development
GO:0048731	0.931	system development
GO:0007154	0.915	cell communication
GO:0048518	0.901	positive regulation of biological process
GO:0023052	0.890	signaling
GO:0071559	0.888	response to transforming growth factor beta
GO:0071363	0.877	cellular response to growth factor stimulus
GO:0071560	0.873	cellular response to transforming growth factor beta stimulus
GO:0007179	0.851	transforming growth factor beta receptor signaling pathway
GO:0045595	0.782	regulation of cell differentiation
GO:0048519	0.772	negative regulation of biological process
GO:0070167	0.766	regulation of biomineral tissue development
GO:0030154	0.757	cell differentiation
GO:0048522	0.716	positive regulation of cellular process
GO:0030500	0.653	regulation of bone mineralization
GO:0042127	0.650	regulation of cell population proliferation
GO:0051094	0.603	positive regulation of developmental process
GO:0045597	0.547	positive regulation of cell differentiation
GO:0008284	0.523	positive regulation of cell population proliferation
GO:0048523	0.512	negative regulation of cellular process
GO:0009888	0.474	tissue development
GO:0001503	0.469	ossification
GO:0009653	0.467	anatomical structure morphogenesis
GO:0048583	0.421	regulation of response to stimulus
GO:2000736	0.405	regulation of stem cell differentiation
GO:0001501	0.386	skeletal system development
GO:0072091	0.363	regulation of stem cell proliferation
GO:0019222	0.351	regulation of metabolic process
GO:0023051	0.324	regulation of signaling
GO:0010646	0.318	regulation of cell communication
GO:0009887	0.318	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005576	0.997	extracellular region
GO:0043227	0.987	membrane-bounded organelle
GO:0062023	0.948	collagen-containing extracellular matrix
GO:0005615	0.939	extracellular space
GO:0031982	0.923	vesicle
GO:0005622	0.801	intracellular anatomical structure
GO:0016020	0.782	membrane
GO:0043231	0.774	intracellular membrane-bounded organelle
GO:0005737	0.728	cytoplasm
GO:0070062	0.402	extracellular exosome
GO:0070013	0.330	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]