StarFunc result for job id Q9NS23

User Input

>input (344 residues)
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS23	1.000	1.000	3.850E-70	344	1.000	1.000	Q9NS23.pdb.gz	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
2	AFDB:Q68FW0	0.544	0.676	2.352E-37	270	0.590	0.752	Q68FW0.pdb.gz
3	AFDB:Q8WWW0	0.540	0.453	1.206E-32	418	0.442	0.364	Q8WWW0.pdb.gz	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
4	AFDB:Q5EBH1	0.433	0.364	1.107E-31	413	0.459	0.383	Q5EBH1.pdb.gz	RASF5_MOUSE Ras association domain-containing protein 5 OS=Mus musculus OX=10090 GN=Rassf5 PE=1 SV=1
5	AFDB:Q22744	0.437	0.257	8.547E-22	615	0.334	0.187	Q22744.pdb.gz	RASF1_CAEEL Ras association domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rsf-1 PE=1 SV=1
6	AFDB:Q86WH2	0.358	0.515	9.390E-21	238	0.282	0.408	Q86WH2.pdb.gz	RASF3_HUMAN Ras association domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RASSF3 PE=1 SV=1
7	AFDB:P50749	0.327	0.344	5.856E-12	326	0.177	0.187	P50749.pdb.gz	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
8	AFDB:Q9H2L5	0.348	0.371	2.188E-11	321	0.174	0.187	Q9H2L5.pdb.gz	RASF4_HUMAN Ras association domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RASSF4 PE=1 SV=2
9	AFDB:Q6ZTQ3	0.346	0.325	6.060E-11	369	0.177	0.165	Q6ZTQ3.pdb.gz	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
10	AFDB:Q80UQ2	0.337	0.329	8.460E-10	353	0.174	0.170	Q80UQ2.pdb.gz	RASF6_MOUSE Ras association domain-containing protein 6 OS=Mus musculus OX=10090 GN=Rassf6 PE=1 SV=2
11	PDB:4ajwA	0.164	0.085	1.834E-2	765	0.067	0.030	4ajwA.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
12	PDB:4ajwB	0.168	0.084	6.854E-2	792	0.064	0.028	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
13	PDB:4rm8A	0.174	0.164	7.277E-2	368	0.026	0.024	4rm8A.pdb.gz
14	PDB:3dbhI	0.170	0.554	1.107E-1	86	0.038	0.151	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
15	PDB:6mdhA	0.146	0.302	1.325E-1	149	0.029	0.067	6mdhA.pdb.gz
16	PDB:3plvA	0.160	0.567	1.493E-1	80	0.035	0.150	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
17	PDB:5k1aF	0.164	0.100	1.493E-1	600	0.038	0.022	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
18	PDB:5xqmA	0.155	0.474	1.493E-1	90	0.038	0.144	5xqmA.pdb.gz
19	PDB:3pgeA	0.162	0.295	1.586E-1	172	0.029	0.058	3pgeA.pdb.gz
20	PDB:4pyuA	0.174	0.634	1.586E-1	76	0.020	0.092	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5FAQ9	0.0	633	340	0.892	0.903	Q5FAQ9_RAT Ras association domain family member 1 OS=Rattus norvegicus OX=10116 GN=Rassf1 PE=4 SV=1
2	Q99MK9	0.0	635	340	0.898	0.909	RASF1_MOUSE Ras association domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rassf1 PE=1 SV=1
3	Q9NS23	0.0	708	344	1.000	1.000	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
4	Q8WWW0	8.19e-88	272	418	0.430	0.354	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
5	Q5EBH1	3.04e-86	268	413	0.436	0.363	RASF5_MOUSE Ras association domain-containing protein 5 OS=Mus musculus OX=10090 GN=Rassf5 PE=1 SV=1
6	Q86WH2	4.75e-49	166	238	0.276	0.399	RASF3_HUMAN Ras association domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RASSF3 PE=1 SV=1
7	Q22744	1.44e-39	149	615	0.259	0.145	RASF1_CAEEL Ras association domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rsf-1 PE=1 SV=1
8	P50749	8.21e-09	58.5	326	0.125	0.132	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
9	Q8BMS9	2.47e-08	57.0	326	0.122	0.129	RASF2_MOUSE Ras association domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rassf2 PE=1 SV=1
10	Q6ZTQ3	4.03e-08	56.6	369	0.134	0.125	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
11	O95267	1.19e-07	55.8	797	0.064	0.028	GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=2
12	H0YKM0	1.34e-07	55.5	848	0.064	0.026	H0YKM0_HUMAN RAS guanyl releasing protein 1 OS=Homo sapiens OX=9606 GN=RASGRP1 PE=1 SV=1
13	Q9Z1S3	1.38e-07	55.5	795	0.064	0.028	GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus OX=10090 GN=Rasgrp1 PE=1 SV=1
14	Q9R1K8	1.39e-07	55.5	795	0.064	0.028	GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus OX=10116 GN=Rasgrp1 PE=1 SV=1
15	Q69ZX7	5.39e-07	53.5	693	0.061	0.030	Q69ZX7_MOUSE MKIAA0846 protein (Fragment) OS=Mus musculus OX=10090 GN=Rasgrp3 PE=2 SV=1
16	Q2PHE9	5.48e-07	53.5	691	0.061	0.030	Q2PHE9_MOUSE RasGRP3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=2 SV=1
17	Q6NZH9	5.67e-07	53.5	691	0.061	0.030	Q6NZH9_MOUSE RAS, guanyl releasing protein 3 OS=Mus musculus OX=10090 GN=Rasgrp3 PE=1 SV=1
18	Q1L9A0	7.13e-07	53.1	687	0.058	0.029	Q1L9A0_DANRE RAS guanyl-releasing protein 1 OS=Danio rerio OX=7955 GN=si:dkey-12o15.1 PE=2 SV=1
19	D4A229	7.63e-07	53.1	890	0.084	0.033	D4A229_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Prkd3 PE=1 SV=1
20	Q8IV61	8.83e-07	53.1	690	0.061	0.030	GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens OX=9606 GN=RASGRP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.025	25.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF16517 Nore1-SARAH	1.6e-14	64.7	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
3	PF00788 RA	1.8e-15	68.7	Ras association (RalGDS/AF-6) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361892	0.996	Serine/threonine-protein kinase 4
2	9606.ENSP00000407586	0.996	GTPase HRas
3	9606.ENSP00000429744	0.993	Serine/threonine-protein kinase 3
4	9606.ENSP00000258149	0.987	E3 ubiquitin-protein ligase Mdm2
5	9606.ENSP00000451594	0.985	Modulator of apoptosis 1
6	9606.ENSP00000363668	0.977	Death domain-associated protein 6
7	9606.ENSP00000325313	0.973	Microtubule-associated protein 1S
8	9606.ENSP00000256078	0.972	GTPase KRas
9	9606.ENSP00000324729	0.972	Protein salvador homolog 1
10	9606.ENSP00000361540	0.971	Cell division cycle protein 20 homolog
11	9606.ENSP00000359206	0.912	F-box/WD repeat-containing protein 1A
12	9606.ENSP00000364270	0.912	DNA repair protein complementing XP-A cells
13	9606.ENSP00000462099	0.907	Ras association domain-containing protein 5
14	9606.ENSP00000437550	0.905	Serine/threonine-protein kinase LATS1
15	9606.ENSP00000227507	0.896	G1/S-specific cyclin-D1
16	9606.ENSP00000358548	0.880	GTPase NRas
17	9606.ENSP00000246792	0.835	Ras-related protein R-Ras
18	9606.ENSP00000296755	0.835	Microtubule-associated protein 1B
19	9606.ENSP00000286827	0.832	T-lymphoma invasion and metastasis-inducing protein 1
20	9606.ENSP00000302111	0.831	Methylated-DNA--protein-cysteine methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.987	ion binding
GO:0042802	0.964	identical protein binding
GO:0043169	0.870	cation binding
GO:0008270	0.854	zinc ion binding
GO:0019899	0.414	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.990	cellular response to stimulus
GO:0007165	0.981	signal transduction
GO:0048518	0.980	positive regulation of biological process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0035556	0.971	intracellular signal transduction
GO:0051246	0.936	regulation of protein metabolic process
GO:0009893	0.925	positive regulation of metabolic process
GO:0051173	0.921	positive regulation of nitrogen compound metabolic process
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0031399	0.904	regulation of protein modification process
GO:0051247	0.900	positive regulation of protein metabolic process
GO:0031398	0.874	positive regulation of protein ubiquitination
GO:0051726	0.866	regulation of cell cycle
GO:0006950	0.823	response to stress
GO:0007264	0.752	small GTPase mediated signal transduction
GO:0048519	0.718	negative regulation of biological process
GO:0048522	0.631	positive regulation of cellular process
GO:0033554	0.624	cellular response to stress
GO:0031323	0.606	regulation of cellular metabolic process
GO:0048523	0.586	negative regulation of cellular process
GO:0010564	0.500	regulation of cell cycle process
GO:1902806	0.378	regulation of cell cycle G1/S phase transition
GO:0065008	0.339	regulation of biological quality
GO:0048583	0.318	regulation of response to stimulus
GO:0007265	0.316	Ras protein signal transduction
GO:0008152	0.311	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005737	0.946	cytoplasm
GO:0005829	0.931	cytosol
GO:0005856	0.926	cytoskeleton
GO:0070013	0.881	intracellular organelle lumen
GO:0031981	0.865	nuclear lumen
GO:0015630	0.764	microtubule cytoskeleton
GO:0071944	0.724	cell periphery
GO:0005886	0.670	plasma membrane
GO:0005654	0.484	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]