StarFunc result for job id Q9NS37

User Input

>input (354 residues)
MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDE
GELEAGRGSRGGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHL
DPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSG
SAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLA
AENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSP
AGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS37	1.000	1.000	2.602E-56	354	1.000	1.000	Q9NS37.pdb.gz	ZHANG_HUMAN CREB/ATF bZIP transcription factor OS=Homo sapiens OX=9606 GN=CREBZF PE=1 SV=2
2	AFDB:Q91ZR3	0.705	0.697	4.882E-44	358	0.833	0.824	Q91ZR3.pdb.gz	ZHANG_MOUSE CREB/ATF bZIP transcription factor OS=Mus musculus OX=10090 GN=Crebzf PE=1 SV=2
3	AFDB:Q9VUX7	0.115	0.109	3.031E-3	377	0.184	0.172	Q9VUX7.pdb.gz	Q9VUX7_DROME GH16214p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
4	AFDB:A5D8S8	0.113	0.123	3.243E-3	319	0.164	0.182	A5D8S8.pdb.gz	HEXI1_DANRE Protein HEXIM1 OS=Danio rerio OX=7955 GN=hexim1 PE=2 SV=1
5	AFDB:Q86UE8	0.165	0.081	9.591E-3	772	0.147	0.067	Q86UE8.pdb.gz	TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2
6	AFDB:Q59XM1	0.140	0.071	1.026E-2	791	0.110	0.049	Q59XM1.pdb.gz	EXO84_CANAL Exocyst complex component EXO84 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXO84 PE=3 SV=3
7	AFDB:Q03935	0.187	0.174	1.765E-2	383	0.121	0.112	Q03935.pdb.gz	YAP6_YEAST AP-1-like transcription factor YAP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP6 PE=1 SV=1
8	AFDB:Q5XJ95	0.213	0.243	2.021E-2	305	0.130	0.151	Q5XJ95.pdb.gz	Q5XJ95_DANRE PRKC apoptosis WT1 regulator protein OS=Danio rerio OX=7955 GN=pawrl PE=2 SV=1
9	AFDB:Q5A034	0.112	0.057	3.248E-2	903	0.068	0.027	Q5A034.pdb.gz	Q5A034_CANAL DNA replication licensing factor MCM2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MCM2 PE=3 SV=1
10	AFDB:Q8NFJ8	0.133	0.127	5.978E-2	381	0.184	0.171	Q8NFJ8.pdb.gz	BHE22_HUMAN Class E basic helix-loop-helix protein 22 OS=Homo sapiens OX=9606 GN=BHLHE22 PE=2 SV=1
11	PDB:4m4wO	0.047	0.065	2.375	250	0.008	0.012	4m4wO.pdb.gz
12	PDB:5lj5O	0.090	0.110	4.371	283	0.065	0.081	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
13	PDB:2fkbC	0.043	0.086	5.005	167	0.011	0.024	2fkbC.pdb.gz
14	PDB:4fidA	0.048	0.053	5.005	318	0.011	0.013	4fidA.pdb.gz	Heterotrimeric G-protein Signaling Is Critical to Pathogenic Processes in Entamoeba histolytica.
15	PDB:6y7gB	0.048	0.098	5.005	165	0.006	0.012	6y7gB.pdb.gz	Structure of the human RAB3C in complex with GDP
16	PDB:4zi2A	0.051	0.082	6.134	185	0.003	0.005	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
17	PDB:7mt2W	0.045	0.186	6.134	77	0.008	0.039	7mt2W.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
18	PDB:1j72A	0.057	0.059	6.564	337	0.017	0.018	1j72A.pdb.gz
19	PDB:6lthQ	0.097	0.270	6.564	105	0.082	0.276	6lthQ.pdb.gz	Structure of nucleosome-bound human BAF complex.
20	PDB:5ondA	0.046	0.106	7.024	135	0.003	0.007	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NS37	0.0	698	354	1.000	1.000	ZHANG_HUMAN CREB/ATF bZIP transcription factor OS=Homo sapiens OX=9606 GN=CREBZF PE=1 SV=2
2	Q91ZR3	1.43e-161	457	358	0.833	0.824	ZHANG_MOUSE CREB/ATF bZIP transcription factor OS=Mus musculus OX=10090 GN=Crebzf PE=1 SV=2
3	A7SXY9	7.36e-17	82.8	367	0.167	0.161	A7SXY9_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g248021 PE=1 SV=1
4	A7S7R0	1.55e-14	76.3	376	0.158	0.149	A7S7R0_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g243410 PE=1 SV=1
5	Q8TEY5	9.46e-06	49.3	395	0.107	0.096	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
6	Q99941	3.90e-05	47.8	703	0.065	0.033	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
7	Q5RH85	4.66e-05	47.8	653	0.065	0.035	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
8	O35451	5.57e-05	47.4	699	0.065	0.033	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
9	Q68CJ9	1.07e-04	46.2	461	0.065	0.050	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
10	Q91XE9	1.71e-04	45.8	479	0.065	0.048	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
11	Q61817	0.002	42.4	404	0.073	0.064	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
12	F6VAN0	0.004	41.2	656	0.051	0.027	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
13	G3V909	0.004	41.6	656	0.051	0.027	ATF6A_RAT Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Rattus norvegicus OX=10116 GN=Atf6 PE=2 SV=1
14	P18850	0.006	40.8	670	0.051	0.027	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
15	Q9D2A5	0.014	39.3	370	0.062	0.059	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
16	O24646	0.015	38.1	168	0.105	0.220	HY5_ARATH Transcription factor HY5 OS=Arabidopsis thaliana OX=3702 GN=HY5 PE=1 SV=1
17	A1L224	0.036	38.5	519	0.062	0.042	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
18	O43889	0.081	37.0	371	0.079	0.075	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
19	Q54ER9	0.16	36.2	602	0.071	0.042	DIMB_DICDI Basic-leucine zipper transcription factor B OS=Dictyostelium discoideum OX=44689 GN=dimB PE=1 SV=1
20	Q54WN7	0.17	36.2	631	0.054	0.030	BZPF_DICDI Probable basic-leucine zipper transcription factor F OS=Dictyostelium discoideum OX=44689 GN=bzpF PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	21	16.8	Autophagy protein 16 (ATG16)
2	PF00170 bZIP_1	0.0014	30.0	bZIP transcription factor
3	PF07716 bZIP_2	28	16.2	Basic region leucine zipper
4	PF04977 DivIC	1.5e+02	13.5	Septum formation initiator
5	PF09755 DUF2046	2.4e+02	12.2	Uncharacterized conserved protein H4 (DUF2046)
6	PF02183 HALZ	4e+02	12.6	Homeobox associated leucine zipper
7	PF09726 Macoilin	7.4	16.7	Macoilin family
8	PF16331 TolA_bind_tri	2e+02	13.4	TolA binding protein trimerisation
9	PF01166 TSC22	17	17.0	TSC-22/dip/bun family
10	PF09325 Vps5	2.8e+02	12.5	Vps5 C terminal like
11	PF06156 YabA	5.6e+02	12.6	Initiation control protein YabA
12	PF06005 ZapB	2	20.2	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000433459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309555	0.865	Host cell factor 1
2	9606.ENSP00000342136	0.837	Cyclic AMP-responsive element-binding protein 3
3	9606.ENSP00000336790	0.765	Cyclic AMP-dependent transcription factor ATF-4
4	9606.ENSP00000357596	0.735	Cyclic AMP-responsive element-binding protein 3-like protein 4
5	9606.ENSP00000216037	0.684	X-box-binding protein 1
6	9606.ENSP00000356840	0.642	POU domain, class 2, transcription factor 1
7	9606.ENSP00000262367	0.640	CREB-binding protein
8	9606.ENSP00000329357	0.631	Transcription factor Sp1
9	9606.ENSP00000296015	0.572	Belongs to the TTC14 family
10	9606.ENSP00000269305	0.568	Cellular tumor antigen p53
11	9606.ENSP00000337194	0.562	Serine/threonine-protein kinase PRP4 homolog
12	9606.ENSP00000265872	0.557	Cell division cycle and apoptosis regulator protein 1
13	9606.ENSP00000247461	0.537	Calnexin
14	9606.ENSP00000239938	0.500	Early growth response protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.987	identical protein binding
GO:0140110	0.306	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0031328	0.982	positive regulation of cellular biosynthetic process
GO:0045935	0.982	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.981	cellular process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0048519	0.979	negative regulation of biological process
GO:0048523	0.974	negative regulation of cellular process
GO:0045944	0.972	positive regulation of transcription by RNA polymerase II
GO:0045892	0.957	negative regulation of DNA-templated transcription
GO:0050896	0.947	response to stimulus
GO:0071840	0.542	cellular component organization or biogenesis
GO:0016043	0.516	cellular component organization
GO:0065009	0.494	regulation of molecular function
GO:0009607	0.442	response to biotic stimulus
GO:0044419	0.437	biological process involved in interspecies interaction between organisms
GO:0009605	0.433	response to external stimulus
GO:0006325	0.431	chromatin organization
GO:0051090	0.429	regulation of DNA-binding transcription factor activity
GO:0008152	0.416	metabolic process
GO:0071704	0.347	organic substance metabolic process
GO:0045814	0.347	negative regulation of gene expression, epigenetic
GO:0009615	0.326	response to virus
GO:0051716	0.310	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005667	0.998	transcription regulator complex
GO:0005739	0.995	mitochondrion
GO:0140513	0.995	nuclear protein-containing complex
GO:0090575	0.993	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]