StarFunc result for job id Q9NS40

User Input

>input (1196 residues)
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSFESE
GEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGSEY
QRPIIQLMRTSQPEASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYVHPIRHPSLPDSSLSTVGIVGLHRHVSDPGLPGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3DJX4	0.552	0.557	0.000	1186	0.573	0.578	B3DJX4.pdb.gz
2	AFDB:O08962	0.576	0.592	0.000	1163	0.580	0.597	O08962.pdb.gz	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
3	AFDB:Q9NS40	1.000	1.000	0.000	1196	1.000	1.000	Q9NS40.pdb.gz	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
4	AFDB:Q9H252	0.527	0.631	1.411E-97	994	0.505	0.608	Q9H252.pdb.gz	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
5	AFDB:O54853	0.524	0.656	1.494E-94	950	0.503	0.633	O54853.pdb.gz	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
6	PDB:7rhsA	0.333	0.819	1.115E-26	456	0.097	0.254	7rhsA.pdb.gz
7	PDB:7n15A	0.320	0.680	3.627E-25	520	0.099	0.227	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
8	PDB:7wswA	0.319	0.729	4.889E-25	472	0.103	0.261	7wswA.pdb.gz
9	PDB:7rhsD	0.319	0.798	2.368E-23	441	0.074	0.200	7rhsD.pdb.gz
10	PDB:7calA	0.319	0.785	3.706E-23	444	0.089	0.241	7calA.pdb.gz
11	PDB:7o4hB	0.320	0.744	7.705E-22	468	0.098	0.250	7o4hB.pdb.gz
12	PDB:7xufA	0.311	0.703	2.673E-21	476	0.084	0.212	7xufA.pdb.gz
13	PDB:7o4hD	0.226	0.636	2.386E-13	383	0.049	0.154	7o4hD.pdb.gz
14	PDB:6eo1A	0.112	0.277	3.149E-8	355	0.060	0.203	6eo1A.pdb.gz
15	PDB:4f7zA	0.100	0.125	6.981E-8	946	0.026	0.033	4f7zA.pdb.gz
16	AFDB:Q98SN3	0.084	0.122	7.220E-5	805	0.043	0.063	Q98SN3.pdb.gz	Q98SN3_CHICK Aryl hydrocarbon receptor nuclear translocator OS=Gallus gallus OX=9031 PE=2 SV=1
17	AFDB:Q9W705	0.076	0.062	1.312E-4	1516	0.120	0.095	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
18	AFDB:P79832	0.083	0.132	3.056E-4	723	0.033	0.054	P79832.pdb.gz	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
19	AFDB:E7FDK6	0.083	0.132	6.132E-4	731	0.050	0.082	E7FDK6.pdb.gz
20	AFDB:Q66T02	0.064	0.069	1.925E-3	1073	0.111	0.124	Q66T02.pdb.gz	PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EFJ9	0.0	738	829	0.339	0.489	UN103_CAEEL Potassium voltage-gated channel unc-103 OS=Caenorhabditis elegans OX=6239 GN=unc-103 PE=1 SV=1
2	O08962	0.0	1234	1163	0.521	0.536	KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus OX=10116 GN=Kcnh2 PE=1 SV=1
3	O35219	0.0	1234	1162	0.522	0.537	KCNH2_MOUSE Potassium voltage-gated channel subfamily H member 2 OS=Mus musculus OX=10090 GN=Kcnh2 PE=1 SV=2
4	O54852	0.0	2322	1195	0.943	0.944	KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus OX=10116 GN=Kcnh7 PE=1 SV=1
5	O54853	0.0	954	950	0.378	0.476	KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus OX=10116 GN=Kcnh6 PE=1 SV=1
6	Q12809	0.0	1222	1159	0.520	0.537	KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2 PE=1 SV=1
7	Q7JPB9	0.0	741	855	0.288	0.404	Q7JPB9_DROME GH12235p OS=Drosophila melanogaster OX=7227 GN=sei PE=2 SV=1
8	Q8JH78	0.0	1234	1186	0.591	0.596	Q8JH78_DANRE Erg K+ channel OS=Danio rerio OX=7955 GN=erg PE=2 SV=1
9	Q9H252	0.0	954	994	0.379	0.456	KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens OX=9606 GN=KCNH6 PE=1 SV=1
10	Q9NS40	0.0	2492	1196	1.000	1.000	KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens OX=9606 GN=KCNH7 PE=1 SV=2
11	K4EHU2	9.44e-158	498	956	0.203	0.254	K4EHU2_DANRE Potassium voltage-gated channel subfamily H member 1b OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
12	Q8NCM2	2.71e-154	489	988	0.200	0.242	KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens OX=9606 GN=KCNH5 PE=1 SV=3
13	Q02280	2.95e-154	494	1174	0.203	0.207	KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster OX=7227 GN=eag PE=1 SV=2
14	Q9EPI9	3.59e-154	489	988	0.200	0.242	KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus OX=10116 GN=Kcnh5 PE=2 SV=1
15	Q63472	4.59e-154	488	962	0.204	0.254	KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus OX=10116 GN=Kcnh1 PE=1 SV=1
16	Q108P3	7.95e-154	487	959	0.200	0.249	Q108P3_DANRE Potassium voltage-gated channel subfamily H member 1 OS=Danio rerio OX=7955 GN=Eag1 PE=2 SV=1
17	O95259	5.94e-151	481	989	0.204	0.247	KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens OX=9606 GN=KCNH1 PE=1 SV=1
18	O18965	1.10e-150	480	987	0.204	0.247	KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus OX=9913 GN=KCNH1 PE=2 SV=2
19	Q60603	1.67e-150	479	989	0.204	0.247	KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus OX=10090 GN=Kcnh1 PE=1 SV=2
20	Q96L42	2.14e-148	477	1107	0.210	0.227	KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	3.1e+02	13.0	Autophagy protein 16 (ATG16)
2	PF00027 cNMP_binding	9.5e-09	46.6	Cyclic nucleotide-binding domain
3	PF00520 Ion_trans	1.2e-33	127.9	Ion transport protein
4	PF07885 Ion_trans_2	4.5e-08	44.3	Ion channel
5	PF00989 PAS	0.089	24.2	PAS fold
6	PF08447 PAS_3	0.017	26.7	PAS fold
7	PF08448 PAS_4	25	16.6	PAS fold
8	PF13188 PAS_8	14	17.1	PAS domain
9	PF13426 PAS_9	1.9e-14	65.2	PAS domain
10	PF10267 Tmemb_cc2	1e+03	10.3	Predicted transmembrane and coiled-coil 2 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000155840	0.803	Potassium voltage-gated channel subfamily KQT member 1
2	9606.ENSP00000315654	0.756	Potassium voltage-gated channel subfamily G member 2
3	9606.ENSP00000394842	0.749	Grancalcin
4	9606.ENSP00000333496	0.735	Potassium voltage-gated channel subfamily D member 2
5	9606.ENSP00000352035	0.734	Potassium voltage-gated channel subfamily KQT member 2
6	9606.ENSP00000218176	0.732	Potassium voltage-gated channel subfamily D member 1
7	9606.ENSP00000345055	0.722	Potassium voltage-gated channel subfamily KQT member 5
8	9606.ENSP00000360806	0.720	Potassium voltage-gated channel subfamily B member 1
9	9606.ENSP00000385968	0.716	Potassium voltage-gated channel subfamily S member 3
10	9606.ENSP00000367323	0.714	Voltage-gated potassium channel subunit beta-2
11	9606.ENSP00000433109	0.714	Potassium voltage-gated channel subfamily A member 2
12	9606.ENSP00000302719	0.713	Voltage-gated potassium channel subunit beta-3
13	9606.ENSP00000262916	0.701	Potassium voltage-gated channel subfamily KQT member 4
14	9606.ENSP00000434241	0.701	Potassium voltage-gated channel subfamily C member 3
15	9606.ENSP00000435954	0.701	Potassium voltage-gated channel subfamily V member 1
16	9606.ENSP00000221444	0.700	Potassium voltage-gated channel subfamily A member 7
17	9606.ENSP00000304127	0.695	Potassium voltage-gated channel subfamily G member 3
18	9606.ENSP00000312129	0.693	Potassium voltage-gated channel subfamily G member 4
19	9606.ENSP00000328511	0.688	Potassium voltage-gated channel subfamily A member 4
20	9606.ENSP00000373648	0.688	Potassium voltage-gated channel subfamily KQT member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0099094	0.989	ligand-gated monoatomic cation channel activity
GO:0005515	0.988	protein binding
GO:0005242	0.934	inward rectifier potassium channel activity
GO:0044877	0.779	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006813	0.989	potassium ion transport
GO:0048511	0.851	rhythmic process
GO:0007623	0.772	circadian rhythm
GO:0065007	0.623	biological regulation
GO:0050789	0.579	regulation of biological process
GO:0009987	0.507	cellular process
GO:0050794	0.459	regulation of cellular process
GO:0055085	0.387	transmembrane transport
GO:0032501	0.355	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.495	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]