StarFunc result for job id Q9NS56

User Input

>input (1045 residues)
MGSQPPLGSPLSREEGEAPPPAPASEGRRRSRRVRLRGSCRHRPSFLGCRELAASAPARP
APASSEIMASAAKEFKMDNFSPKAGTSKLQQTVPADASPDSKCPICLDRFDNVSYLDRCL
HKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRY
RTTLTRERNASVYSPSGPVNRRTTTPPDSGVLFEGLGISTRPRDVEIPQFMRQIAVRRPT
TADERSLRKIQEQDIINFRRTLYRAGARVRNIEDGGRYRDISAEFFRRNPACLHRLVPWL
KRELTVLFGAHGSLVNIVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFAR
SPFNMAAFDQHANYDCPAPSYEEGSHSDSSVITISPDEAETQELDINVATVSQAPWDDET
PGPSYSSSEQVHVTMSSLLNTSDSSDEELVTGGATSQIQGVQTNDDLNNDSDDSSDNCVI
VGFVKPLAERTPELVELSSDSEDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLG
KDEQINKGHCDSSTRIKSKKEEKRSTSLSSPRNLNSSVRGDRVYSPYNHRHRKRGRSRSS
DSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRSQTL
SLSSESTSRSRSRSSDHGKRRSRSRNRDRYYLRNNYGSRYKWEYTYYSRNKDRDGYESSY
RRRTLSRAHYSRQSSSPEFRVQSFSERTNARKKNNHSERKYYYYERHRSRSLSSNRSRTA
STGTDRVRNEKPGGKRKYKTRHLEGTNEVAQPSREFASKAKDSHYQKSSSKLDGNYKNES
DTFSDSRSSDRETKHKRRKRKTRSLSVEIVYEGKATDTTKHHKKKKKKHKKKHKKHHGDN
ASRSPVVITIDSDSDKDSEVKEDTECDNSGPQDPLQNEFLAPSLEPFETKDVVTIEAEFG
VLDKECDIATLSNNLNNANKTVDNIPPLAASVEQTLDVREESTFVSDLENQPSNIVSLQT
EPSRQLPSPRTSLMSVCLGRDCDMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80Z37	0.304	0.307	0.000	1033	0.860	0.870	Q80Z37.pdb.gz	TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus OX=10090 GN=Topors PE=1 SV=1
2	AFDB:Q9NS56	1.000	1.000	0.000	1045	1.000	1.000	Q9NS56.pdb.gz	TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens OX=9606 GN=TOPORS PE=1 SV=1
3	AFDB:E7F1A2	0.183	0.191	1.126E-42	999	0.330	0.345	E7F1A2.pdb.gz
4	AFDB:A0A0R4ICA2	0.201	0.220	1.465E-39	939	0.324	0.361	A0A0R4ICA2.pdb.gz	A0A0R4ICA2_DANRE E3 ubiquitin-protein ligase Topors OS=Danio rerio OX=7955 GN=toporsb PE=4 SV=1
5	AFDB:O77086	0.048	0.042	3.803E-5	1571	0.138	0.092	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
6	AFDB:Q9R0I7	0.047	0.039	5.115E-5	1386	0.131	0.099	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
7	AFDB:Q57Y65	0.059	0.045	1.183E-3	1617	0.151	0.098	Q57Y65.pdb.gz	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1
8	AFDB:Q02308	0.042	0.041	1.332E-3	1077	0.162	0.157	Q02308.pdb.gz	HLES_DROME Protein hairless OS=Drosophila melanogaster OX=7227 GN=H PE=1 SV=2
9	AFDB:Q24079	0.046	0.038	1.500E-3	1221	0.142	0.121	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
10	AFDB:Q6P4S6	0.040	0.035	2.271E-3	1311	0.157	0.125	Q6P4S6.pdb.gz	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
11	PDB:4r8pL	0.054	0.205	3.203E-3	254	0.020	0.083	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
12	PDB:5a31B	0.053	0.489	1.496E-2	84	0.018	0.226	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
13	PDB:7oniR	0.053	0.514	1.684E-2	86	0.018	0.221	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:4a0cF	0.045	0.526	3.046E-2	80	0.020	0.263	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	PDB:2lgvA	0.043	0.394	3.639E-2	100	0.014	0.150	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
16	PDB:5dkaA	0.042	0.410	3.861E-2	96	0.013	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:5gm6a	0.044	0.349	4.096E-2	123	0.016	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:8a3tU	0.051	0.348	5.192E-2	114	0.015	0.140	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
19	PDB:5l9uB	0.047	0.567	8.852E-2	71	0.016	0.239	5l9uB.pdb.gz
20	PDB:5gmkq	0.045	0.115	1.601E-1	387	0.010	0.026	5gmkq.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1N329	0.0	1591	1037	0.903	0.910	F1N329_BOVIN TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase OS=Bos taurus OX=9913 GN=TOPORS PE=4 SV=3
2	F1SE69	0.0	1597	979	0.876	0.935	F1SE69_PIG TOP1 binding arginine/serine rich protein, E3 ubiquitin ligase OS=Sus scrofa OX=9823 GN=TOPORS PE=4 SV=3
3	Q80Z37	0.0	1462	1033	0.843	0.853	TOPRS_MOUSE E3 ubiquitin-protein ligase Topors OS=Mus musculus OX=10090 GN=Topors PE=1 SV=1
4	Q9NS56	0.0	2147	1045	1.000	1.000	TOPRS_HUMAN E3 ubiquitin-protein ligase Topors OS=Homo sapiens OX=9606 GN=TOPORS PE=1 SV=1
5	A0A0R4ICA2	6.71e-130	419	939	0.207	0.230	A0A0R4ICA2_DANRE E3 ubiquitin-protein ligase Topors OS=Danio rerio OX=7955 GN=toporsb PE=4 SV=1
6	Q9V8P9	1.26e-17	90.9	1038	0.033	0.034	TOPRS_DROME E3 ubiquitin-protein ligase Topors OS=Drosophila melanogaster OX=7227 GN=Topors PE=1 SV=1
7	P28990	5.52e-12	72.0	532	0.024	0.047	ICP0_EHV1B E3 ubiquitin-protein ligase ICP0 OS=Equine herpesvirus 1 (strain Ab4p) OX=31520 GN=63 PE=1 SV=1
8	K4P3M7	9.62e-12	71.6	683	0.028	0.042	K4P3M7_9ALPH Immediate-early transactivator protein with Zn finger (Cell nucleus) OS=Bovine herpesvirus type 1.1 OX=79889 GN=BICP0 PE=1 SV=1
9	P29128	9.62e-12	71.6	676	0.028	0.043	ICP0_BHV1J E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.1 (strain Jura) OX=31518 GN=BICP0 PE=1 SV=1
10	P87662	9.99e-12	70.5	419	0.024	0.060	P87662_9ALPH Transcriptional protein OS=Equid alphaherpesvirus 1 OX=10326 GN=ICP0 PE=1 SV=1
11	Q8VZ73	7.74e-10	63.5	296	0.068	0.240	Q8VZ73_ARATH Putative RING zinc finger protein OS=Arabidopsis thaliana OX=3702 GN=At2g39100 PE=1 SV=1
12	Q9P1Y6	1.72e-06	54.7	1649	0.025	0.016	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
13	Q99590	2.08e-06	54.7	1463	0.017	0.012	SCAFB_HUMAN Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2
14	Q9ZT42	6.31e-06	52.0	375	0.027	0.075	RHF2A_ARATH E3 ubiquitin-protein ligase RHF2A OS=Arabidopsis thaliana OX=3702 GN=RHF2A PE=2 SV=1
15	Q63625	1.06e-05	52.4	1685	0.021	0.013	PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Phrf1 PE=1 SV=2
16	O76064	1.21e-05	51.6	485	0.029	0.062	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
17	Q8NHY2	2.40e-05	50.8	731	0.019	0.027	COP1_HUMAN E3 ubiquitin-protein ligase COP1 OS=Homo sapiens OX=9606 GN=COP1 PE=1 SV=1
18	Q9R1A8	2.93e-05	50.4	733	0.019	0.027	COP1_MOUSE E3 ubiquitin-protein ligase COP1 OS=Mus musculus OX=10090 GN=Cop1 PE=1 SV=2
19	Q8VC56	3.72e-05	50.1	488	0.028	0.059	RNF8_MOUSE E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1
20	Q9VNE0	4.14e-05	50.4	2296	0.019	0.009	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	75	14.6	Prokaryotic RING finger family 4
2	PF04423 Rad50_zn_hook	57	14.9	Rad50 zinc hook motif
3	PF12861 zf-ANAPC11	12	17.3	Anaphase-promoting complex subunit 11 RING-H2 finger
4	PF00097 zf-C3HC4	9.1e-06	36.8	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	1.3e-05	36.3	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	3.5e-06	38.0	Zinc finger, C3HC4 type (RING finger)
7	PF15227 zf-C3HC4_4	0.78	21.2	zinc finger of C3HC4-type, RING
8	PF12678 zf-rbx1	0.041	25.5	RING-H2 zinc finger domain
9	PF13639 zf-RING_2	3.2e-05	35.5	Ring finger domain
10	PF14570 zf-RING_4	3.4e+02	12.4	RING/Ubox like zinc-binding domain
11	PF14634 zf-RING_5	0.11	23.8	zinc-RING finger domain
12	PF13445 zf-RING_UBOX	0.0035	28.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354522	0.994	DNA topoisomerase 1
2	9606.ENSP00000348056	0.979	SUMO-conjugating enzyme UBC9
3	9606.ENSP00000269305	0.974	Cellular tumor antigen p53
4	9606.ENSP00000376077	0.973	Small ubiquitin-related modifier 1
5	9606.ENSP00000363019	0.947	Ubiquitin-conjugating enzyme E2 D1
6	9606.ENSP00000378402	0.934	Paired amphipathic helix protein Sin3a
7	9606.ENSP00000464030	0.927	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
8	9606.ENSP00000300093	0.844	Serine/threonine-protein kinase PLK1
9	9606.ENSP00000365019	0.841	Spindlin-1
10	9606.ENSP00000248846	0.758	Gamma-tubulin complex component 6
11	9606.ENSP00000418960	0.754	Breast cancer type 1 susceptibility protein
12	9606.ENSP00000260383	0.753	Gamma-tubulin complex component 4
13	9606.ENSP00000262891	0.726	MAP/microtubule affinity-regulating kinase 4
14	9606.ENSP00000371308	0.726	Centromere protein J
15	9606.ENSP00000480316	0.726	Gamma-tubulin complex component 5
16	9606.ENSP00000303709	0.725	Ubiquitin-conjugating enzyme E2 E1
17	9606.ENSP00000281871	0.720	Mitotic spindle organizing protein 2B
18	9606.ENSP00000311500	0.720	Mitotic spindle organizing protein 2A
19	9606.ENSP00000359398	0.720	Biogenesis of lysosome-related organelles complex 1 subunit 2
20	9606.ENSP00000367049	0.720	Mitotic-spindle organizing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	0.997	ubiquitin-protein transferase activity
GO:0061630	0.991	ubiquitin protein ligase activity
GO:1901363	0.984	heterocyclic compound binding
GO:0097159	0.984	organic cyclic compound binding
GO:0003676	0.965	nucleic acid binding
GO:0019899	0.954	enzyme binding
GO:0003677	0.851	DNA binding
GO:0003823	0.827	antigen binding
GO:0019789	0.802	SUMO transferase activity
GO:0044547	0.612	DNA topoisomerase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.996	cellular process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0048518	0.978	positive regulation of biological process
GO:0080090	0.978	regulation of primary metabolic process
GO:0035556	0.978	intracellular signal transduction
GO:0012501	0.975	programmed cell death
GO:0010604	0.974	positive regulation of macromolecule metabolic process
GO:0097190	0.974	apoptotic signaling pathway
GO:0033554	0.972	cellular response to stress
GO:0008630	0.960	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0019538	0.957	protein metabolic process
GO:0051171	0.955	regulation of nitrogen compound metabolic process
GO:0070647	0.942	protein modification by small protein conjugation or removal
GO:0051173	0.929	positive regulation of nitrogen compound metabolic process
GO:0032446	0.917	protein modification by small protein conjugation
GO:0044237	0.879	cellular metabolic process
GO:0048522	0.821	positive regulation of cellular process
GO:0031323	0.814	regulation of cellular metabolic process
GO:0010468	0.653	regulation of gene expression
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0044260	0.386	cellular macromolecule metabolic process
GO:0051246	0.377	regulation of protein metabolic process
GO:0019219	0.373	regulation of nucleobase-containing compound metabolic process
GO:0018193	0.373	peptidyl-amino acid modification
GO:0051179	0.334	localization
GO:0016925	0.320	protein sumoylation
GO:2001141	0.317	regulation of RNA biosynthetic process
GO:0006355	0.311	regulation of DNA-templated transcription
GO:0051247	0.308	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005856	0.997	cytoskeleton
GO:0005634	0.993	nucleus
GO:0005815	0.991	microtubule organizing center
GO:0032391	0.966	photoreceptor connecting cilium
GO:0031974	0.960	membrane-enclosed lumen
GO:0043233	0.949	organelle lumen
GO:0070013	0.943	intracellular organelle lumen
GO:0031981	0.931	nuclear lumen
GO:0005654	0.878	nucleoplasm
GO:0005737	0.818	cytoplasm
GO:0005829	0.772	cytosol
GO:0036064	0.767	ciliary basal body
GO:0032991	0.701	protein-containing complex
GO:1902494	0.585	catalytic complex
GO:0000151	0.493	ubiquitin ligase complex
GO:0000930	0.392	gamma-tubulin complex
GO:0030496	0.387	midbody
GO:0016607	0.356	nuclear speck
GO:0005814	0.351	centriole
GO:0016605	0.334	PML body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]