StarFunc result for job id Q9NS61

User Input

>input (270 residues)
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAA
PASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPS
GIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDR
LNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNK
DGVVTIEEFIESCQKDENIMRSMQLFDNVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JJ69	0.834	0.834	1.744E-38	270	0.974	0.974	Q9JJ69.pdb.gz	KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus OX=10090 GN=Kcnip2 PE=1 SV=2
2	AFDB:Q9JM47	0.672	0.708	1.245E-26	256	0.593	0.625	Q9JM47.pdb.gz	CSEN_RAT Calsenilin OS=Rattus norvegicus OX=10116 GN=Kcnip3 PE=1 SV=1
3	PDB:7ukhI	0.620	0.910	1.322E-26	181	0.670	1.000	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
4	AFDB:A2AHT3	0.660	0.629	1.992E-26	284	0.596	0.567	A2AHT3.pdb.gz	A2AHT3_MOUSE Kv channel interacting protein 3, calsenilin OS=Mus musculus OX=10090 GN=Kcnip3 PE=1 SV=1
5	AFDB:A0A2R8QMM6	0.671	0.681	4.590E-26	266	0.600	0.609	A0A2R8QMM6.pdb.gz
6	AFDB:Q6PHZ8	0.684	0.737	6.969E-26	250	0.607	0.656	Q6PHZ8.pdb.gz	KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1
7	AFDB:Q8R426	0.659	0.780	6.200E-24	227	0.511	0.608	Q8R426.pdb.gz	KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnip1 PE=1 SV=2
8	PDB:1s1eA	0.616	0.903	5.558E-22	181	0.485	0.724	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
9	PDB:2julA	0.603	0.872	8.279E-19	181	0.519	0.773	2julA.pdb.gz	NMR structure of DREAM: Implications for Ca(2+)-dependent DNA binding and protein dimerization.
10	AFDB:Q09711	0.603	0.845	4.845E-18	190	0.289	0.411	Q09711.pdb.gz	NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ncs1 PE=1 SV=2
11	AFDB:P36608	0.614	0.860	5.104E-18	191	0.296	0.419	P36608.pdb.gz	NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans OX=6239 GN=ncs-1 PE=2 SV=2
12	AFDB:A0A024R8B2	0.637	0.896	5.378E-18	190	0.315	0.447	A0A024R8B2.pdb.gz
13	AFDB:Q4WLA4	0.628	0.876	6.981E-18	190	0.293	0.416	Q4WLA4.pdb.gz	Q4WLA4_ASPFU Calcium sensor (NCS-1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G14240 PE=4 SV=1
14	PDB:5aanA	0.590	0.857	4.343E-16	183	0.267	0.393	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
15	PDB:1fpwA	0.549	0.748	1.571E-12	190	0.281	0.400	1fpwA.pdb.gz	Structure and calcium-binding properties of Frq1, a novel calcium sensor in the yeast Saccharomyces cerevisiae.
16	PDB:2d8nA	0.542	0.719	2.149E-12	197	0.226	0.310	2d8nA.pdb.gz
17	PDB:1omrA	0.528	0.688	2.513E-12	201	0.241	0.323	1omrA.pdb.gz	Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
18	PDB:2lcpA	0.515	0.695	3.437E-12	190	0.307	0.437	2lcpA.pdb.gz	The C-terminal tail of human neuronal calcium sensor 1 regulates the conformational stability of the ca(2+)-activated state.
19	PDB:2l2eA	0.303	0.401	1.195E-10	189	0.289	0.413	2l2eA.pdb.gz
20	PDB:5x9aB	0.525	0.695	4.182E-10	198	0.181	0.247	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JJ69	0.0	552	270	0.974	0.974	KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus OX=10090 GN=Kcnip2 PE=1 SV=2
2	Q9JM59	0.0	549	270	0.967	0.967	KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnip2 PE=1 SV=2
3	Q9NS61	0.0	563	270	1.000	1.000	KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens OX=9606 GN=KCNIP2 PE=1 SV=3
4	Q6PIL6	1.04e-126	362	250	0.619	0.668	KCIP4_HUMAN Kv channel-interacting protein 4 OS=Homo sapiens OX=9606 GN=KCNIP4 PE=1 SV=1
5	Q6PHZ8	1.82e-126	361	250	0.619	0.668	KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus OX=10090 GN=Kcnip4 PE=1 SV=1
6	Q99MG9	1.82e-126	361	250	0.619	0.668	KCIP4_RAT Kv channel-interacting protein 4 OS=Rattus norvegicus OX=10116 GN=Kcnip4 PE=1 SV=1
7	Q9QXT8	1.66e-113	328	256	0.622	0.656	CSEN_MOUSE Calsenilin OS=Mus musculus OX=10090 GN=Kcnip3 PE=1 SV=2
8	A2AHT3	3.30e-113	329	284	0.611	0.581	A2AHT3_MOUSE Kv channel interacting protein 3, calsenilin OS=Mus musculus OX=10090 GN=Kcnip3 PE=1 SV=1
9	Q9Y2W7	4.74e-113	327	256	0.607	0.641	CSEN_HUMAN Calsenilin OS=Homo sapiens OX=9606 GN=KCNIP3 PE=1 SV=1
10	Q9JM47	1.30e-112	326	256	0.622	0.656	CSEN_RAT Calsenilin OS=Rattus norvegicus OX=10116 GN=Kcnip3 PE=1 SV=1
11	Q9JJ57	3.15e-112	324	227	0.522	0.621	KCIP1_MOUSE Kv channel-interacting protein 1 OS=Mus musculus OX=10090 GN=Kcnip1 PE=1 SV=2
12	Q8R426	1.11e-111	323	227	0.519	0.617	KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnip1 PE=1 SV=2
13	Q9NZI2	1.11e-111	323	227	0.519	0.617	KCIP1_HUMAN Kv channel-interacting protein 1 OS=Homo sapiens OX=9606 GN=KCNIP1 PE=1 SV=2
14	Q6PBP8	6.39e-111	322	259	0.604	0.629	Q6PBP8_DANRE Kv channel interacting protein 3, calsenilin OS=Danio rerio OX=7955 GN=kcnip3 PE=2 SV=1
15	Q9VBL2	1.07e-64	203	229	0.330	0.389	Q9VBL2_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5890 PE=4 SV=2
16	P62166	1.77e-57	184	190	0.307	0.437	NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens OX=9606 GN=NCS1 PE=1 SV=2
17	P62167	1.77e-57	184	190	0.307	0.437	NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus OX=9031 GN=NCS1 PE=1 SV=2
18	P62168	1.77e-57	184	190	0.307	0.437	NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus OX=10116 GN=Ncs1 PE=1 SV=2
19	Q8BNY6	1.77e-57	184	190	0.307	0.437	NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus OX=10090 GN=Ncs1 PE=1 SV=3
20	Q804C0	9.01e-57	182	190	0.304	0.432	Q804C0_DANRE Neuronal calcium sensor 1 OS=Danio rerio OX=7955 GN=ncs1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	2.5e+02	13.0	Caleosin related protein
2	PF00404 Dockerin_1	9.2	17.9	Dockerin type I domain
3	PF00036 EF-hand_1	3.2e-18	74.9	EF hand
4	PF12763 EF-hand_4	2.6	19.4	Cytoskeletal-regulatory complex EF hand
5	PF13202 EF-hand_5	8e-15	64.8	EF hand
6	PF13405 EF-hand_6	4.1e-16	68.4	EF-hand domain
7	PF13499 EF-hand_7	5.3e-20	83.0	EF-hand domain pair
8	PF13833 EF-hand_8	6.1e-09	46.8	EF-hand domain pair
9	PF14658 EF-hand_9	3.3	19.5	EF-hand domain
10	PF10591 SPARC_Ca_bdg	0.013	27.2	Secreted protein acidic and rich in cysteine Ca binding region
11	PF05256 UPF0223	58	15.5	Uncharacterised protein family (UPF0223)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000017281

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000018680	0.939	Potassium voltage-gated channel, Shal-related subfamily, member 3
2	43179.ENSSTOP00000018715	0.904	Potassium voltage-gated channel, Shal-related subfamily, member 1
3	43179.ENSSTOP00000003768	0.804	Kv channel interacting protein 1
4	43179.ENSSTOP00000022131	0.769	Potassium voltage-gated channel, Shaw-related subfamily, member 1
5	43179.ENSSTOP00000012820	0.730	Kv channel interacting protein 4
6	43179.ENSSTOP00000003441	0.697	Belongs to the peptidase S9B family.
7	43179.ENSSTOP00000013255	0.694	Voltage-dependent L-type calcium channel subunit alpha
8	43179.ENSSTOP00000019490	0.686	Potassium voltage-gated channel, shaker-related subfamily, member 4
9	43179.ENSSTOP00000019974	0.681	Potassium voltage-gated channel, KQT-like subfamily, member 1
10	43179.ENSSTOP00000021570	0.651	Uncharacterized protein
11	43179.ENSSTOP00000011863	0.641	Phosphatidylinositol 4-kinase, catalytic, beta
12	43179.ENSSTOP00000011099	0.638	Potassium voltage-gated channel, Isk-related family, member 3
13	43179.ENSSTOP00000010423	0.637	Sodium channel protein
14	43179.ENSSTOP00000008732	0.632	MAM domain containing glycosylphosphatidylinositol anchor 1
15	43179.ENSSTOP00000022963	0.624	Potassium voltage-gated channel, Isk-related family, member 2
16	43179.ENSSTOP00000020974	0.615	Potassium voltage-gated channel, KQT-like subfamily, member 2
17	43179.ENSSTOP00000014972	0.613	Uncharacterized protein
18	43179.ENSSTOP00000016971	0.593	Potassium voltage-gated channel, Shab-related subfamily, member 1
19	43179.ENSSTOP00000012969	0.563	Belongs to the peptidase S9B family.
20	43179.ENSSTOP00000006632	0.511	Potassium voltage-gated channel, subfamily H (eag-related), member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0015459	0.997	potassium channel regulator activity
GO:0005509	0.996	calcium ion binding
GO:0005216	0.404	monoatomic ion channel activity
GO:0022836	0.390	gated channel activity
GO:0046873	0.379	metal ion transmembrane transporter activity
GO:0005261	0.368	monoatomic cation channel activity
GO:0005244	0.360	voltage-gated monoatomic ion channel activity
GO:0005267	0.311	potassium channel activity
GO:0022843	0.308	voltage-gated monoatomic cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0051049	0.992	regulation of transport
GO:0050794	0.991	regulation of cellular process
GO:0043269	0.983	regulation of monoatomic ion transport
GO:0034762	0.959	regulation of transmembrane transport
GO:0043266	0.953	regulation of potassium ion transport
GO:1904062	0.939	regulation of monoatomic cation transmembrane transport
GO:0009987	0.933	cellular process
GO:1901379	0.775	regulation of potassium ion transmembrane transport
GO:0051179	0.662	localization
GO:0006810	0.499	transport
GO:0030001	0.484	metal ion transport
GO:0032501	0.475	multicellular organismal process
GO:0006813	0.425	potassium ion transport
GO:0098662	0.326	inorganic cation transmembrane transport
GO:0098655	0.326	monoatomic cation transmembrane transport
GO:0071805	0.323	potassium ion transmembrane transport
GO:0048518	0.307	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0034705	0.996	potassium channel complex
GO:0008076	0.988	voltage-gated potassium channel complex
GO:0042995	0.804	cell projection
GO:0005622	0.768	intracellular anatomical structure
GO:0120025	0.765	plasma membrane bounded cell projection
GO:0043005	0.743	neuron projection
GO:0005737	0.682	cytoplasm
GO:0036477	0.477	somatodendritic compartment
GO:0043226	0.314	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.311	K(+)(in) = K(+)(out)

[back to server]