StarFunc result for job id Q9NS62

User Input

>input (852 residues)
MKPMLKDFSNLLLVVLCDYVLGEAEYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVS
VLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKS
AFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARR
NSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKF
GYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERR
TIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTETWGLWQPWSQCSATCGDGV
RERRRVCLTSFPSSPVCPGMSLEASLCSLEECAAFQPSSPSPLQPQGPVKSNNIVTVTGI
SLCLFIIIATVLITLWRRFGRPAKCSTPARHNSIHSPSFRKNSDEENICELSEQRGSFSD
GGDGPTGSPGDTGIPLTYRRSGPVPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEM
KKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAG
ERPPSRLDLNVTQASCAISPSQTLIRKSQARHVGSRGGPSERSHARNAHFRRTASFHEAR
QARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRG
PLNPLPKSYTLGQPLRKPDLGDHQAGLVAGIERTEPHRARRGPSPSHKSVSRKQSSPISP
KDNYQRVSSLSPSQCRKDKCQSFPTHPEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEEDE
TTSTLSVEKLVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R064	0.495	0.495	0.000	852	1.000	1.000	A0A024R064.pdb.gz
2	AFDB:Q9JM61	0.504	0.504	3.490E-103	851	0.781	0.781	Q9JM61.pdb.gz	THSD1_MOUSE Thrombospondin type-1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Thsd1 PE=1 SV=2
3	AFDB:Q4ZHG4	0.111	0.061	6.357E-12	1894	0.164	0.074	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
4	AFDB:Q2Q0I9	0.098	0.056	1.365E-11	1779	0.161	0.077	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
5	AFDB:F1R2D2	0.099	0.059	2.898E-10	1687	0.156	0.079	F1R2D2.pdb.gz
6	AFDB:Q9VPZ7	0.100	0.074	6.889E-10	1342	0.137	0.087	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
7	PDB:6h03A	0.126	0.100	9.743E-10	1223	0.049	0.034	6h03A.pdb.gz
8	PDB:4lnvB	0.096	0.078	1.025E-9	1063	0.047	0.038	4lnvB.pdb.gz
9	PDB:4ziqA	0.109	0.076	2.987E-9	1450	0.052	0.030	4ziqA.pdb.gz
10	AFDB:O55005	0.126	0.073	7.171E-9	1651	0.157	0.081	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
11	PDB:4lnvA	0.127	0.100	1.308E-8	1276	0.062	0.042	4lnvA.pdb.gz
12	PDB:7q1yA	0.113	0.086	1.449E-8	1374	0.050	0.031	7q1yA.pdb.gz
13	PDB:7nycA	0.126	0.084	2.537E-8	1542	0.052	0.029	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
14	PDB:7q5zA	0.115	0.089	4.221E-8	1344	0.052	0.033	7q5zA.pdb.gz
15	PDB:5a42A	0.100	0.067	5.445E-8	1597	0.053	0.028	5a42A.pdb.gz
16	AFDB:Q14126	0.096	0.079	7.855E-8	1118	0.143	0.109	Q14126.pdb.gz	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
17	AFDB:M9NE05	0.096	0.057	9.152E-8	2192	0.135	0.052	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
18	AFDB:A0A0G2JZA1	0.087	0.057	9.630E-8	1512	0.129	0.073	A0A0G2JZA1.pdb.gz	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
19	PDB:4rtdA	0.111	0.091	2.047E-7	1122	0.053	0.040	4rtdA.pdb.gz
20	PDB:7vonA	0.118	0.087	1.156E-6	1399	0.050	0.031	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JM61	0.0	1377	851	0.785	0.786	THSD1_MOUSE Thrombospondin type-1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Thsd1 PE=1 SV=2
2	Q9NS62	0.0	1759	852	1.000	1.000	THSD1_HUMAN Thrombospondin type-1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THSD1 PE=1 SV=1
3	Q7Z292	1.69e-09	58.5	125	0.032	0.216	Q7Z292_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs adt-2 OS=Caenorhabditis elegans OX=6239 GN=adt-2 PE=4 SV=1
4	Q7Z291	8.41e-07	55.5	975	0.035	0.031	Q7Z291_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=adt-2 PE=4 SV=2
5	Q19204	1.12e-06	55.1	1020	0.035	0.029	ADT2_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs adt-2 OS=Caenorhabditis elegans OX=6239 GN=adt-2 PE=1 SV=5
6	F1QPQ6	1.69e-06	54.3	1101	0.032	0.025	F1QPQ6_DANRE Sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba OS=Danio rerio OX=7955 GN=sema5ba PE=4 SV=1
7	D3YXG0	1.88e-06	54.7	5634	0.025	0.004	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
8	Q8IUL8	2.18e-06	53.9	1156	0.034	0.025	CILP2_HUMAN Cartilage intermediate layer protein 2 OS=Homo sapiens OX=9606 GN=CILP2 PE=2 SV=2
9	O15072	3.37e-06	53.5	1205	0.033	0.023	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
10	Q96RW7	5.54e-06	53.1	5635	0.025	0.004	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
11	E9Q287	7.60e-06	52.4	1204	0.033	0.023	E9Q287_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
12	B2RY45	7.67e-06	52.4	1204	0.033	0.023	B2RY45_MOUSE Adamts3 protein OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
13	B2RY57	7.67e-06	52.4	1203	0.033	0.023	B2RY57_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1
14	G3X9D2	7.67e-06	52.4	1203	0.033	0.023	G3X9D2_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
15	O75339	1.56e-05	51.2	1184	0.032	0.023	CILP1_HUMAN Cartilage intermediate layer protein 1 OS=Homo sapiens OX=9606 GN=CILP PE=1 SV=4
16	Q8CG65	2.79e-05	50.8	4998	0.028	0.005	SSPO_MOUSE SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2
17	Q60519	2.90e-05	50.4	1093	0.027	0.021	SEM5B_MOUSE Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2
18	O95450	5.84e-05	49.3	1211	0.026	0.018	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
19	Q13591	5.95e-05	49.3	1074	0.026	0.020	SEM5A_HUMAN Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE=1 SV=3
20	Q9UHI8	6.01e-05	49.3	967	0.032	0.028	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19030 TSP1_ADAMTS	0.096	24.3	Thrombospondin type 1 domain
2	PF19035 TSP1_CCN	13	17.5	CCN3 Nov like TSP1 domain
3	PF19028 TSP1_spondin	0.0024	29.5	Spondin-like TSP1 domain
4	PF00090 TSP_1	2e-06	39.2	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299164	0.950	ADAM metallopeptidase with thrombospondin type 1 motif 15
2	9606.ENSP00000257359	0.939	A disintegrin and metalloproteinase with thrombospondin motifs 8
3	9606.ENSP00000347484	0.925	Thrombospondin type-1 domain-containing protein 4
4	9606.ENSP00000483599	0.919	Spondin-2
5	9606.ENSP00000355751	0.918	Thrombospondin-2
6	9606.ENSP00000260356	0.915	Thrombospondin-1
7	9606.ENSP00000286744	0.914	ADAMTS-like protein 3
8	9606.ENSP00000284987	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 5
9	9606.ENSP00000369921	0.911	ADAMTS-like protein 1
10	9606.ENSP00000358035	0.910	ADAMTS-like protein 4
11	9606.ENSP00000370443	0.905	ADAM metallopeptidase with thrombospondin type 1 motif 6
12	9606.ENSP00000373472	0.903	A disintegrin and metalloproteinase with thrombospondin motifs 7
13	9606.ENSP00000418735	0.903	A disintegrin and metalloproteinase with thrombospondin motifs 9
14	9606.ENSP00000460236	0.903	Spondin-1
15	9606.ENSP00000247153	0.902	Properdin
16	9606.ENSP00000284984	0.902	A disintegrin and metalloproteinase with thrombospondin motifs 1
17	9606.ENSP00000268070	0.901	ADAM metallopeptidase with thrombospondin type 1 motif 17
18	9606.ENSP00000274181	0.901	ADAM metallopeptidase with thrombospondin type 1 motif 16
19	9606.ENSP00000282849	0.901	ADAM metallopeptidase with thrombospondin type 1 motif 18
20	9606.ENSP00000374071	0.901	A disintegrin and metalloproteinase with thrombospondin motifs 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0050840	0.992	extracellular matrix binding
GO:0016787	0.457	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0016043	0.975	cellular component organization
GO:0007155	0.864	cell adhesion
GO:0031589	0.828	cell-substrate adhesion
GO:0034330	0.795	cell junction organization
GO:0007160	0.794	cell-matrix adhesion
GO:0150115	0.780	cell-substrate junction organization
GO:0034329	0.590	cell junction assembly
GO:0050794	0.376	regulation of cellular process
GO:0007044	0.369	cell-substrate junction assembly
GO:0032502	0.311	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.999	endomembrane system
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0071944	0.941	cell periphery
GO:0031982	0.922	vesicle
GO:0005829	0.884	cytosol
GO:0031410	0.579	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.457	Hydrolases.

[back to server]