StarFunc result for job id Q9NS73

User Input

>input (344 residues)
MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKL
QSLSAFQPALLFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFS
IGDLQEEEKHKESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVR
EFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSML
RDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSG
KRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS73	1.000	1.000	2.289E-53	344	1.000	1.000	Q9NS73.pdb.gz	MBIP1_HUMAN MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP PE=1 SV=2
2	AFDB:Q99LQ1	0.502	0.505	1.939E-39	341	0.814	0.821	Q99LQ1.pdb.gz	MBIP1_MOUSE MAP3K12-binding inhibitory protein 1 OS=Mus musculus OX=10090 GN=Mbip PE=1 SV=1
3	AFDB:Q9V4C1	0.083	0.042	1.374E-1	884	0.166	0.064	Q9V4C1.pdb.gz	Q9V4C1_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1674 PE=1 SV=2
4	AFDB:Q9VE87	0.112	0.068	2.891E-1	604	0.131	0.075	Q9VE87.pdb.gz	HMW_DROME Protein hemingway OS=Drosophila melanogaster OX=7227 GN=hmw PE=2 SV=2
5	PDB:6cnbS	0.101	0.134	4.560E-1	217	0.099	0.157	6cnbS.pdb.gz	Structural visualization of RNA polymerase III transcription machineries.
6	AFDB:P22809	0.092	0.085	7.332E-1	382	0.119	0.107	P22809.pdb.gz	BAGP_DROME Homeobox protein bagpipe OS=Drosophila melanogaster OX=7227 GN=bap PE=2 SV=3
7	AFDB:Q8IYF1	0.117	0.060	7.332E-1	753	0.140	0.064	Q8IYF1.pdb.gz	ELOA2_HUMAN Elongin-A2 OS=Homo sapiens OX=9606 GN=ELOA2 PE=1 SV=2
8	AFDB:P09077	0.112	0.099	7.801E-1	417	0.119	0.098	P09077.pdb.gz	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
9	AFDB:Q8N350	0.106	0.056	7.801E-1	705	0.157	0.077	Q8N350.pdb.gz	CBARP_HUMAN Voltage-dependent calcium channel beta subunit-associated regulatory protein OS=Homo sapiens OX=9606 GN=CBARP PE=1 SV=3
10	AFDB:P18488	0.085	0.063	8.300E-1	497	0.090	0.062	P18488.pdb.gz	EMS_DROME Homeotic protein empty spiracles OS=Drosophila melanogaster OX=7227 GN=ems PE=2 SV=2
11	AFDB:P31360	0.092	0.074	9.998E-1	445	0.128	0.099	P31360.pdb.gz	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
12	PDB:3jd5O	0.090	0.158	1.087	173	0.044	0.087	3jd5O.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
13	PDB:7l08AL	0.100	0.177	1.230	174	0.044	0.086	7l08AL.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
14	PDB:1cnt1	0.077	0.158	1.678	150	0.047	0.107	1cnt1.pdb.gz
15	PDB:7pntL	0.111	0.172	1.899	176	0.052	0.102	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:7enal	0.090	0.226	2.150	126	0.055	0.151	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
17	PDB:5svaU	0.094	0.185	2.288	156	0.081	0.179	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
18	PDB:6yxxAf	0.075	0.146	2.288	139	0.049	0.122	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:7c4jH	0.084	0.119	2.288	242	0.061	0.087	7c4jH.pdb.gz
20	PDB:4v8mAG	0.078	0.154	2.434	141	0.035	0.085	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99LQ1	0.0	542	341	0.785	0.792	MBIP1_MOUSE MAP3K12-binding inhibitory protein 1 OS=Mus musculus OX=10090 GN=Mbip PE=1 SV=1
2	Q9NS73	0.0	711	344	1.000	1.000	MBIP1_HUMAN MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP PE=1 SV=2
3	S4R2X9	0.0	607	299	0.849	0.977	S4R2X9_HUMAN MAP3K12 binding inhibitory protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=MBIP PE=1 SV=1
4	Q9VBX2	1.51e-17	84.7	367	0.189	0.177	MOC2B_DROME Molybdopterin synthase catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Mocs2B PE=1 SV=2
5	Q585J4	0.15	36.2	326	0.108	0.113	Q585J4_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.26G5.380 PE=3 SV=1
6	Q9C7X5	2.3	32.3	324	0.061	0.065	NAS4_ARATH Probable nicotianamine synthase 4 OS=Arabidopsis thaliana OX=3702 GN=NAS4 PE=2 SV=1
7	O35683	2.6	30.0	70	0.044	0.214	NDUA1_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 OS=Mus musculus OX=10090 GN=Ndufa1 PE=1 SV=1
8	Q9WVQ0	2.8	32.3	1022	0.073	0.024	PMFBP_MOUSE Polyamine-modulated factor 1-binding protein 1 OS=Mus musculus OX=10090 GN=Pmfbp1 PE=2 SV=1
9	P0AEQ3	3.2	31.6	248	0.061	0.085	GLNH_ECOLI Glutamine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=glnH PE=1 SV=1
10	C8VT14	3.9	32.0	1313	0.073	0.019	C8VT14_EMENI MAP kinase kinase kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sskB PE=3 SV=1
11	P0A9M8	4.6	31.6	714	0.049	0.024	PTA_ECOLI Phosphate acetyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=pta PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	5.3e+02	12.5	Apg6 coiled-coil region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316114	0.989	SAGA-associated factor 29
2	9606.ENSP00000359295	0.989	Protein Dr1
3	9606.ENSP00000351446	0.986	WD repeat-containing protein 5
4	9606.ENSP00000306983	0.985	YEATS domain-containing protein 2
5	9606.ENSP00000481091	0.984	Transcriptional adapter 2-alpha
6	9606.ENSP00000392318	0.983	Cysteine-rich protein 2-binding protein
7	9606.ENSP00000307684	0.979	Transcriptional adapter 3
8	9606.ENSP00000359837	0.978	ZZ-type zinc finger-containing protein 3
9	9606.ENSP00000225916	0.972	Histone acetyltransferase KAT2A
10	9606.ENSP00000263754	0.967	Histone acetyltransferase KAT2B
11	9606.ENSP00000420176	0.896	DNA polymerase epsilon subunit 4
12	9606.ENSP00000363286	0.890	DNA polymerase epsilon subunit 3
13	9606.ENSP00000358335	0.842	Mitogen-activated protein kinase kinase kinase 7
14	9606.ENSP00000247843	0.762	YEATS domain-containing protein 4
15	9606.ENSP00000361363	0.749	DNA methyltransferase 1-associated protein 1
16	9606.ENSP00000318297	0.744	RuvB-like 1
17	9606.ENSP00000352925	0.743	Transformation/transcription domain-associated protein
18	9606.ENSP00000374213	0.739	E1A-binding protein p400
19	9606.ENSP00000443292	0.736	Protein FAM222A
20	9606.ENSP00000397552	0.735	Actin-like protein 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0004860	0.999	protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0016573	0.989	histone acetylation
GO:0048518	0.983	positive regulation of biological process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0048583	0.972	regulation of response to stimulus
GO:0043966	0.971	histone H3 acetylation
GO:0051726	0.956	regulation of cell cycle
GO:0010468	0.956	regulation of gene expression
GO:0031399	0.954	regulation of protein modification process
GO:0048522	0.948	positive regulation of cellular process
GO:0006355	0.948	regulation of DNA-templated transcription
GO:0051302	0.944	regulation of cell division
GO:0048584	0.913	positive regulation of response to stimulus
GO:0010604	0.899	positive regulation of macromolecule metabolic process
GO:0080135	0.895	regulation of cellular response to stress
GO:0031056	0.884	regulation of histone modification
GO:0006357	0.881	regulation of transcription by RNA polymerase II
GO:0090311	0.862	regulation of protein deacetylation
GO:0031063	0.833	regulation of histone deacetylation
GO:0009966	0.729	regulation of signal transduction
GO:1902531	0.618	regulation of intracellular signal transduction
GO:0070302	0.589	regulation of stress-activated protein kinase signaling cascade
GO:0043408	0.564	regulation of MAPK cascade
GO:0032872	0.518	regulation of stress-activated MAPK cascade
GO:0046328	0.448	regulation of JNK cascade
GO:0009987	0.436	cellular process
GO:0051173	0.329	positive regulation of nitrogen compound metabolic process
GO:0031325	0.304	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.998	cytosol
GO:0000123	0.997	histone acetyltransferase complex
GO:0070461	0.988	SAGA-type complex
GO:0140672	0.943	ATAC complex
GO:0005730	0.857	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]