StarFunc result for job id Q9NS84

User Input

>input (486 residues)
MKGRRRRRREYCKFALLLVLYTLVLLLVPSVLDGGRDGDKGAEHCPGLQRSLGVWSLEAA
AAGEREQGAEARAAEEGGANQSPRFPSNLSGAVGEAVSREKQHIYVHATWRTGSSFLGEL
FNQHPDVFYLYEPMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAAR
APDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAE
CRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQ
VLRTRQRGDRFHRVLLAHGVGARPGGQSRALPAAPRADFFLTGALEVICEAWLRDLLFAR
GAPAWLRRRYLRLRYEDLVRQPRAQLRRLLRFSGLRALAALDAFALNMTRGAAYGADRPF
HLSARDAREAVHAWRERLSREQVRQVEAACAPAMRLLAYPRSGEEGDAEQPREGETPLEM
DADGAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS84	1.000	1.000	4.329E-74	486	1.000	1.000	Q9NS84.pdb.gz	CHST7_HUMAN Carbohydrate sulfotransferase 7 OS=Homo sapiens OX=9606 GN=CHST7 PE=1 SV=2
2	AFDB:Q9EP78	0.913	0.917	9.840E-64	484	0.874	0.878	Q9EP78.pdb.gz	CHST7_MOUSE Carbohydrate sulfotransferase 7 OS=Mus musculus OX=10090 GN=Chst7 PE=2 SV=1
3	AFDB:Q80WV3	0.646	0.594	2.233E-35	530	0.420	0.385	Q80WV3.pdb.gz	CHST2_MOUSE Carbohydrate sulfotransferase 2 OS=Mus musculus OX=10090 GN=Chst2 PE=1 SV=3
4	AFDB:Q9R1I1	0.635	0.790	1.059E-24	388	0.288	0.361	Q9R1I1.pdb.gz	CHST4_MOUSE Carbohydrate sulfotransferase 4 OS=Mus musculus OX=10090 GN=Chst4 PE=1 SV=1
5	AFDB:Q9GZX3	0.625	0.765	1.676E-24	395	0.270	0.332	Q9GZX3.pdb.gz	CHST6_HUMAN Carbohydrate sulfotransferase 6 OS=Homo sapiens OX=9606 GN=CHST6 PE=1 SV=1
6	AFDB:Q8NCG5	0.618	0.772	3.833E-24	386	0.272	0.342	Q8NCG5.pdb.gz	CHST4_HUMAN Carbohydrate sulfotransferase 4 OS=Homo sapiens OX=9606 GN=CHST4 PE=1 SV=2
7	AFDB:Q9QUP4	0.610	0.745	6.652E-24	395	0.274	0.337	Q9QUP4.pdb.gz	CHST5_MOUSE Carbohydrate sulfotransferase 5 OS=Mus musculus OX=10090 GN=Chst5 PE=2 SV=1
8	AFDB:Q9GZS9	0.620	0.730	3.992E-23	411	0.286	0.338	Q9GZS9.pdb.gz	CHST5_HUMAN Carbohydrate sulfotransferase 5 OS=Homo sapiens OX=9606 GN=CHST5 PE=2 SV=3
9	AFDB:O43916	0.598	0.702	4.377E-23	411	0.263	0.311	O43916.pdb.gz	CHST1_HUMAN Carbohydrate sulfotransferase 1 OS=Homo sapiens OX=9606 GN=CHST1 PE=1 SV=1
10	AFDB:Q7LGC8	0.582	0.590	8.629E-21	479	0.245	0.248	Q7LGC8.pdb.gz	CHST3_HUMAN Carbohydrate sulfotransferase 3 OS=Homo sapiens OX=9606 GN=CHST3 PE=1 SV=3
11	PDB:3u3kA	0.282	0.440	4.401E-4	289	0.101	0.170	3u3kA.pdb.gz	The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
12	PDB:2gwhB	0.252	0.390	1.326E-3	288	0.093	0.156	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
13	PDB:4jvlA	0.282	0.443	1.388E-3	292	0.072	0.120	4jvlA.pdb.gz	Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
14	PDB:2zytX	0.270	0.417	1.453E-3	291	0.086	0.144	2zytX.pdb.gz	Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
15	PDB:3bfxA	0.283	0.495	1.522E-3	253	0.074	0.142	3bfxA.pdb.gz	Crystal Structures of Human Sulfotransferases Sult1B1 and Sult1C1 Complexed with the Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
16	PDB:1q1qA	0.295	0.484	1.593E-3	278	0.105	0.183	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.
17	PDB:7eovA	0.279	0.451	2.198E-3	274	0.088	0.157	7eovA.pdb.gz	The crystal structure of mouse SULT2A8 reveals the mechanism of 7 alpha-hydroxyl, bile acid sulfation.
18	PDB:3cklB	0.259	0.393	2.409E-3	296	0.091	0.149	3cklB.pdb.gz	Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
19	PDB:3nibA	0.253	0.468	2.522E-3	238	0.101	0.206	3nibA.pdb.gz
20	PDB:1aqyA	0.261	0.406	2.641E-3	283	0.078	0.134	1aqyA.pdb.gz	Crystal structure of estrogen sulphotransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EP78	0.0	788	484	0.874	0.878	CHST7_MOUSE Carbohydrate sulfotransferase 7 OS=Mus musculus OX=10090 GN=Chst7 PE=2 SV=1
2	Q9NS84	0.0	967	486	1.000	1.000	CHST7_HUMAN Carbohydrate sulfotransferase 7 OS=Homo sapiens OX=9606 GN=CHST7 PE=1 SV=2
3	Q9Y4C5	2.61e-113	346	530	0.379	0.347	CHST2_HUMAN Carbohydrate sulfotransferase 2 OS=Homo sapiens OX=9606 GN=CHST2 PE=1 SV=2
4	V9HVX9	2.61e-113	346	530	0.379	0.347	V9HVX9_HUMAN Sulfotransferase OS=Homo sapiens OX=9606 GN=HEL-S-75 PE=2 SV=1
5	Q80WV3	2.09e-112	344	530	0.368	0.338	CHST2_MOUSE Carbohydrate sulfotransferase 2 OS=Mus musculus OX=10090 GN=Chst2 PE=1 SV=3
6	Q8NCG5	3.43e-71	233	386	0.280	0.352	CHST4_HUMAN Carbohydrate sulfotransferase 4 OS=Homo sapiens OX=9606 GN=CHST4 PE=1 SV=2
7	Q9R1I1	6.56e-70	229	388	0.294	0.369	CHST4_MOUSE Carbohydrate sulfotransferase 4 OS=Mus musculus OX=10090 GN=Chst4 PE=1 SV=1
8	Q9GZS9	1.42e-67	224	411	0.296	0.350	CHST5_HUMAN Carbohydrate sulfotransferase 5 OS=Homo sapiens OX=9606 GN=CHST5 PE=2 SV=3
9	Q9GZX3	2.27e-67	223	395	0.296	0.365	CHST6_HUMAN Carbohydrate sulfotransferase 6 OS=Homo sapiens OX=9606 GN=CHST6 PE=1 SV=1
10	Q9QUP4	3.79e-63	212	395	0.267	0.329	CHST5_MOUSE Carbohydrate sulfotransferase 5 OS=Mus musculus OX=10090 GN=Chst5 PE=2 SV=1
11	O43916	2.67e-50	178	411	0.272	0.321	CHST1_HUMAN Carbohydrate sulfotransferase 1 OS=Homo sapiens OX=9606 GN=CHST1 PE=1 SV=1
12	Q7LGC8	2.70e-43	161	479	0.241	0.244	CHST3_HUMAN Carbohydrate sulfotransferase 3 OS=Homo sapiens OX=9606 GN=CHST3 PE=1 SV=3
13	O88199	1.57e-39	150	472	0.245	0.252	CHST3_MOUSE Carbohydrate sulfotransferase 3 OS=Mus musculus OX=10090 GN=Chst3 PE=1 SV=1
14	Q9QZL2	1.88e-38	148	474	0.245	0.251	CHST3_RAT Carbohydrate sulfotransferase 3 OS=Rattus norvegicus OX=10116 GN=Chst3 PE=2 SV=2
15	Q8IZU8	0.027	39.7	1212	0.060	0.024	DSEL_HUMAN Dermatan-sulfate epimerase-like protein OS=Homo sapiens OX=9606 GN=DSEL PE=2 SV=2
16	Q0VBN2	0.056	38.5	1207	0.058	0.023	DSEL_MOUSE Dermatan-sulfate epimerase-like protein OS=Mus musculus OX=10090 GN=Dsel PE=2 SV=1
17	Q8BKN6	0.44	35.4	393	0.060	0.074	HS3SA_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3A1 OS=Mus musculus OX=10090 GN=Hs3st3a1 PE=2 SV=1
18	Q9SNV9	0.47	35.4	509	0.049	0.047	NRAM3_ARATH Metal transporter Nramp3 OS=Arabidopsis thaliana OX=3702 GN=NRAMP3 PE=1 SV=2
19	Q9QZS6	0.66	34.7	390	0.060	0.074	HS3SB_MOUSE Heparan sulfate glucosamine 3-O-sulfotransferase 3B1 OS=Mus musculus OX=10090 GN=Hs3st3b1 PE=2 SV=2
20	Q873N1	1.1	34.3	501	0.051	0.050	GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gwt1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00685 Sulfotransfer_1	5.6e-16	70.4	Sulfotransferase domain
2	PF13469 Sulfotransfer_3	3e-07	42.6	Sulfotransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276055

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305725	0.983	Carbohydrate sulfotransferase 11
2	9606.ENSP00000481912	0.982	Carbohydrate sulfotransferase 12
3	9606.ENSP00000356433	0.977	Uronyl 2-sulfotransferase
4	9606.ENSP00000317404	0.971	Carbohydrate sulfotransferase 13
5	9606.ENSP00000265077	0.921	Versican core protein
6	9606.ENSP00000312506	0.916	Chondroitin sulfate proteoglycan 4
7	9606.ENSP00000052754	0.913	Decorin
8	9606.ENSP00000327336	0.912	Biglycan
9	9606.ENSP00000252575	0.905	Neurocan core protein
10	9606.ENSP00000331210	0.904	Brevican core protein
11	9606.ENSP00000373244	0.900	Chondroitin sulfate proteoglycan 5
12	9606.ENSP00000362207	0.851	Carbohydrate sulfotransferase 3
13	9606.ENSP00000345797	0.843	KRAB box domain containing 4
14	9606.ENSP00000307297	0.803	Carbohydrate sulfotransferase 14
15	9606.ENSP00000363590	0.793	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
16	9606.ENSP00000480916	0.780	Sodium/hydrogen exchanger 7
17	9606.ENSP00000402394	0.778	Carbohydrate sulfotransferase 15
18	9606.ENSP00000429148	0.764	Zinc finger protein 674
19	9606.ENSP00000411816	0.726	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
20	9606.ENSP00000246071	0.643	U2 small nuclear ribonucleoprotein B'

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008146	1.000	sulfotransferase activity
GO:0034481	0.863	chondroitin sulfotransferase activity
GO:0001517	0.855	N-acetylglucosamine 6-O-sulfotransferase activity
GO:0008459	0.839	chondroitin 6-sulfotransferase activity
GO:0005488	0.489	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0050650	0.985	chondroitin sulfate proteoglycan biosynthetic process
GO:0044272	0.975	sulfur compound biosynthetic process
GO:0006024	0.971	glycosaminoglycan biosynthetic process
GO:1903510	0.967	mucopolysaccharide metabolic process
GO:0005975	0.966	carbohydrate metabolic process
GO:0006040	0.948	amino sugar metabolic process
GO:1901071	0.936	glucosamine-containing compound metabolic process
GO:0030204	0.886	chondroitin sulfate metabolic process
GO:0005976	0.640	polysaccharide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.994	membrane
GO:0031090	0.963	organelle membrane
GO:0098588	0.877	bounding membrane of organelle
GO:0000139	0.848	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.8.2.-	1.000	Sulfotransferases.
RHEA:11108	0.839	n 3'-phosphoadenylyl sulfate + chondroitin beta-D-glucuronate = n adenosine 3',5'-bisphosphate + chondroitin 6'-sulfate + 2 H(+)
EC:2.8.2.17	0.839	chondroitin 6-sulfotransferase.

[back to server]