StarFunc result for job id Q9NS86

User Input

>input (450 residues)
MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPG
LPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT
CDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQ
LQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSR
EERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK
FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLL
RKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEG
MAGAIHFLSDVLGPETSRFPAFELDSSKRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS86	1.000	1.000	2.526E-71	450	1.000	1.000	Q9NS86.pdb.gz	LANC2_HUMAN LanC-like protein 2 OS=Homo sapiens OX=9606 GN=LANCL2 PE=1 SV=1
2	PDB:6wq1A	0.876	0.995	2.157E-56	396	0.880	1.000	6wq1A.pdb.gz	LanCLs add glutathione to dehydroamino acids generated at phosphorylated sites in the proteome.
3	AFDB:O43813	0.864	0.973	3.904E-44	399	0.511	0.576	O43813.pdb.gz	LANC1_HUMAN Glutathione S-transferase LANCL1 OS=Homo sapiens OX=9606 GN=LANCL1 PE=1 SV=1
4	PDB:3e6uA	0.867	0.953	8.294E-42	409	0.513	0.565	3e6uA.pdb.gz	Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
5	AFDB:F4IEM5	0.769	0.841	4.913E-28	410	0.349	0.383	F4IEM5.pdb.gz	GCR2_ARATH LanC-like protein GCR2 OS=Arabidopsis thaliana OX=3702 GN=GCR2 PE=1 SV=1
6	PDB:3t33A	0.790	0.870	1.364E-27	407	0.358	0.396	3t33A.pdb.gz	Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
7	AFDB:P46822	0.253	0.222	1.451E-3	540	0.133	0.111	P46822.pdb.gz	KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans OX=6239 GN=klc-2 PE=1 SV=2
8	AFDB:O60476	0.465	0.347	1.586E-3	641	0.158	0.111	O60476.pdb.gz	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
9	AFDB:O81629	0.301	0.242	1.984E-3	609	0.116	0.085	O81629.pdb.gz	KLCR1_ARATH Protein KINESIN LIGHT CHAIN-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=KLCR1 PE=1 SV=1
10	AFDB:P51606	0.372	0.386	3.393E-3	427	0.118	0.124	P51606.pdb.gz	RENBP_HUMAN N-acylglucosamine 2-epimerase OS=Homo sapiens OX=9606 GN=RENBP PE=1 SV=3
11	PDB:2rgkA	0.369	0.397	4.211E-3	409	0.100	0.110	2rgkA.pdb.gz
12	AFDB:A0A125SXN1	0.376	0.243	4.640E-3	756	0.120	0.071	A0A125SXN1.pdb.gz	LCC_LYCCL Pre-alpha-onocerin synthase LCC OS=Lycopodium clavatum OX=3252 GN=LCC PE=1 SV=1
13	AFDB:A8MZ87	0.259	0.234	4.852E-3	521	0.107	0.092	A8MZ87.pdb.gz	A8MZ87_HUMAN Kinesin light chain OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
14	PDB:6trhC	0.318	0.356	5.267E-3	385	0.091	0.106	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.
15	AFDB:O18158	0.163	0.087	5.802E-3	1151	0.111	0.043	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
16	PDB:1fp3A	0.362	0.395	9.849E-3	402	0.089	0.100	1fp3A.pdb.gz
17	PDB:7aoiXI	0.237	0.195	1.347E-2	597	0.136	0.102	7aoiXI.pdb.gz	Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit.
18	PDB:6vptA	0.223	0.210	1.473E-2	483	0.116	0.108	6vptA.pdb.gz
19	PDB:3aniA	0.422	0.484	1.926E-2	378	0.131	0.156	3aniA.pdb.gz
20	PDB:3msvA	0.266	0.314	3.150E-2	352	0.082	0.105	3msvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NS86	0.0	938	450	1.000	1.000	LANC2_HUMAN LanC-like protein 2 OS=Homo sapiens OX=9606 GN=LANCL2 PE=1 SV=1
2	O43813	8.84e-171	487	399	0.513	0.579	LANC1_HUMAN Glutathione S-transferase LANCL1 OS=Homo sapiens OX=9606 GN=LANCL1 PE=1 SV=1
3	O89112	1.43e-169	484	399	0.511	0.576	LANC1_MOUSE Glutathione S-transferase LANCL1 OS=Mus musculus OX=10090 GN=Lancl1 PE=1 SV=1
4	F4IEM5	1.67e-84	267	410	0.380	0.417	GCR2_ARATH LanC-like protein GCR2 OS=Arabidopsis thaliana OX=3702 GN=GCR2 PE=1 SV=1
5	Q8TDI0	2.2	33.5	1954	0.051	0.012	CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens OX=9606 GN=CHD5 PE=1 SV=1
6	P35688	2.6	33.1	1017	0.029	0.013	LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LRG1 PE=1 SV=3
7	Q9VL06	2.8	33.1	2727	0.042	0.007	UFD4_DROME E3 ubiquitin-protein ligase Ufd4 OS=Drosophila melanogaster OX=7227 GN=Ufd4 PE=2 SV=1
8	D3ZD32	3.0	33.1	1948	0.051	0.012	CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Chd5 PE=1 SV=1
9	Q9VBY8	3.5	32.7	1153	0.049	0.019	UN13B_DROME Protein unc-13 homolog 4B OS=Drosophila melanogaster OX=7227 GN=stac PE=1 SV=5
10	Q8YYI3	4.2	32.3	555	0.069	0.056	CCMM_NOSS1 Carboxysome assembly protein CcmM OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=ccmM PE=1 SV=1
11	O82777	4.4	32.3	761	0.051	0.030	SBT3_SOLLC Subtilisin-like protease SBT3 OS=Solanum lycopersicum OX=4081 GN=sbt3 PE=1 SV=1
12	A2A8L1	5.7	32.0	1946	0.049	0.011	CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus OX=10090 GN=Chd5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06662 C5-epim_C	3.4	18.6	D-glucuronyl C5-epimerase C-terminus
2	PF07944 Glyco_hydro_127	6.7	16.8	Beta-L-arabinofuranosidase, GH127
3	PF07470 Glyco_hydro_88	40	14.7	Glycosyl Hydrolase Family 88
4	PF05147 LANC_like	1.1e-99	345.0	Lanthionine synthetase C-like protein
5	PF12415 rpo132	5.2e+02	11.4	Poxvirus DNA dependent RNA polymerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300145	0.709	Mitochondrial inner membrane protease ATP23 homolog
2	9606.ENSP00000285279	0.707	Vesicular, overexpressed in cancer, prosurvival protein 1
3	9606.ENSP00000356444	0.687	Sterile alpha motif domain containing 5
4	9606.ENSP00000465638	0.672	Transmembrane protein 100
5	9606.ENSP00000401566	0.653	Protein ecdysoneless homolog
6	9606.ENSP00000287820	0.635	Peroxisome proliferator-activated receptor gamma
7	9606.ENSP00000388337	0.633	Protein transport protein Sec61 subunit gamma
8	9606.ENSP00000281172	0.630	Epidermal growth factor receptor kinase substrate 8
9	9606.ENSP00000451828	0.626	RAC-alpha serine/threonine-protein kinase
10	9606.ENSP00000478255	0.606	Multidrug resistance protein 1
11	9606.ENSP00000373627	0.600	Septin-14
12	9606.ENSP00000384103	0.600	V-set and transmembrane domain-containing protein 2A
13	9606.ENSP00000296782	0.599	Rapamycin-insensitive companion of mTOR
14	9606.ENSP00000263921	0.589	Cysteine-rich hydrophobic domain-containing protein 2
15	9606.ENSP00000416662	0.553	Zinc finger protein 713
16	9606.ENSP00000275493	0.520	Epidermal growth factor receptor
17	9606.ENSP00000337446	0.518	StAR-related lipid transfer protein 3
18	9606.ENSP00000256707	0.514	Kinase D-interacting substrate of 220 kDa
19	9606.ENSP00000351108	0.501	Heterogeneous nuclear ribonucleoprotein A/B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0070273	0.999	phosphatidylinositol-4-phosphate binding
GO:0032266	0.999	phosphatidylinositol-3-phosphate binding
GO:0010314	0.999	phosphatidylinositol-5-phosphate binding
GO:0003824	0.715	catalytic activity
GO:0043167	0.705	ion binding
GO:0043168	0.485	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0048518	0.981	positive regulation of biological process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0009889	0.964	regulation of biosynthetic process
GO:0019219	0.944	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0010468	0.927	regulation of gene expression
GO:0009966	0.925	regulation of signal transduction
GO:1901419	0.906	regulation of response to alcohol
GO:1905957	0.904	regulation of cellular response to alcohol
GO:0048522	0.902	positive regulation of cellular process
GO:0051252	0.902	regulation of RNA metabolic process
GO:0048519	0.895	negative regulation of biological process
GO:0010556	0.837	regulation of macromolecule biosynthetic process
GO:0048523	0.821	negative regulation of cellular process
GO:1903506	0.795	regulation of nucleic acid-templated transcription
GO:0006355	0.786	regulation of DNA-templated transcription
GO:0009892	0.785	negative regulation of metabolic process
GO:0009787	0.772	regulation of abscisic acid-activated signaling pathway
GO:0009987	0.695	cellular process
GO:0009890	0.624	negative regulation of biosynthetic process
GO:0031324	0.607	negative regulation of cellular metabolic process
GO:0031327	0.576	negative regulation of cellular biosynthetic process
GO:0023056	0.507	positive regulation of signaling
GO:0010647	0.390	positive regulation of cell communication
GO:0009967	0.365	positive regulation of signal transduction
GO:0051172	0.354	negative regulation of nitrogen compound metabolic process
GO:0010605	0.346	negative regulation of macromolecule metabolic process
GO:0008152	0.320	metabolic process
GO:0050896	0.300	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.998	cytosol
GO:0070013	0.996	intracellular organelle lumen
GO:0005634	0.996	nucleus
GO:0005654	0.993	nucleoplasm
GO:0043232	0.945	intracellular non-membrane-bounded organelle
GO:0005856	0.818	cytoskeleton
GO:0005938	0.681	cell cortex
GO:0015629	0.578	actin cytoskeleton
GO:0030863	0.488	cortical cytoskeleton
GO:0030864	0.395	cortical actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]