StarFunc result for job id Q9NS93

User Input

>input (570 residues)
MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISS
NVTFLIFQIHSQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPV
QNMAILLSYSERDPVPGGCNLEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPC
DAGTDQDSRWRLQYDVYQYFLPENDLTEEMLLKHLQRMVSVPQVKASALKVVTLTANDKT
SVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSKVFFTL
FALLGFFICFFGHRFWKTELFFIGFIIMGFFFYILITRLTPIKYDVNLILTAVTGSVGGM
FLVAVWWRFGILSICMLCVGLVLGFLISSVTFFTPLGNLKIFHDDGVFWVTFSCIAILIP
VVFMGCLRILNILTCGVIGSYSVVLAIDSYWSTSLSYITLNVLKRALNKDFHRAFTNVPF
QTNDFIILAVWGMLAVSGITLQIRRERGRPFFPPHPYKLWKQERERRVTNILDPSYHIPP
LRERLYGRLTQIKGLFQKEQPAGERTPLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NS93	1.000	1.000	0.000	570	1.000	1.000	Q9NS93.pdb.gz	TM7S3_HUMAN Transmembrane 7 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM7SF3 PE=2 SV=1
2	AFDB:Q9CRG1	0.947	0.955	9.979E-90	565	0.781	0.788	Q9CRG1.pdb.gz	TM7S3_MOUSE Transmembrane 7 superfamily member 3 OS=Mus musculus OX=10090 GN=Tm7sf3 PE=2 SV=2
3	AFDB:Q66K66	0.324	0.490	2.366E-9	360	0.093	0.147	Q66K66.pdb.gz	TM198_HUMAN Transmembrane protein 198 OS=Homo sapiens OX=9606 GN=TMEM198 PE=1 SV=1
4	AFDB:Q6DFQ7	0.323	0.511	3.239E-9	342	0.093	0.155	Q6DFQ7.pdb.gz	TM198_XENTR Transmembrane protein 198 OS=Xenopus tropicalis OX=8364 GN=tmem198 PE=1 SV=1
5	AFDB:Q8C119	0.215	0.216	4.442E-8	568	0.056	0.056	Q8C119.pdb.gz	NDNF_MOUSE Protein NDNF OS=Mus musculus OX=10090 GN=Ndnf PE=1 SV=2
6	AFDB:Q8TB73	0.208	0.209	4.681E-8	568	0.058	0.058	Q8TB73.pdb.gz	NDNF_HUMAN Protein NDNF OS=Homo sapiens OX=9606 GN=NDNF PE=1 SV=2
7	AFDB:F1QPX0	0.204	0.203	5.478E-8	574	0.060	0.059	F1QPX0.pdb.gz	NDNF_DANRE Protein NDNF OS=Danio rerio OX=7955 GN=ndnf PE=3 SV=2
8	AFDB:Q10063	0.160	0.182	2.377E-6	486	0.047	0.056	Q10063.pdb.gz	EHS1_SCHPO Calcium influx-promoting protein ehs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ehs1 PE=3 SV=1
9	AFDB:Q9W192	0.221	0.216	3.809E-6	587	0.044	0.043	Q9W192.pdb.gz	NDNF_DROME Protein NDNF OS=Drosophila melanogaster OX=7227 GN=nord PE=1 SV=2
10	AFDB:Q6FJU2	0.148	0.144	3.436E-5	591	0.068	0.066	Q6FJU2.pdb.gz	Q6FJU2_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=MID1 PE=4 SV=1
11	PDB:6pxvA	0.126	0.091	3.477E-4	823	0.072	0.050	6pxvA.pdb.gz
12	PDB:7u7nC	0.139	0.345	4.068E-4	200	0.051	0.145	7u7nC.pdb.gz
13	PDB:3besR	0.140	0.270	1.430E-3	250	0.063	0.144	3besR.pdb.gz
14	PDB:7z0lB	0.117	0.169	2.174E-3	370	0.074	0.114	7z0lB.pdb.gz
15	PDB:5mj3A	0.119	0.200	6.528E-3	302	0.056	0.106	5mj3A.pdb.gz
16	PDB:6pyhD	0.133	0.098	6.528E-3	798	0.058	0.041	6pyhD.pdb.gz
17	PDB:7d56C	0.090	0.082	9.419E-3	640	0.040	0.036	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
18	PDB:5hp5A	0.104	0.093	1.290E-2	669	0.042	0.036	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
19	PDB:7d4yB	0.096	0.093	1.509E-2	601	0.042	0.040	7d4yB.pdb.gz
20	PDB:6rrnA	0.068	0.051	1.861E-2	989	0.047	0.027	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CRG1	0.0	923	565	0.763	0.770	TM7S3_MOUSE Transmembrane 7 superfamily member 3 OS=Mus musculus OX=10090 GN=Tm7sf3 PE=2 SV=2
2	Q9NS93	0.0	1168	570	1.000	1.000	TM7S3_HUMAN Transmembrane 7 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM7SF3 PE=2 SV=1
3	Q6DFQ7	1.5	33.9	342	0.111	0.184	TM198_XENTR Transmembrane protein 198 OS=Xenopus tropicalis OX=8364 GN=tmem198 PE=1 SV=1
4	P76398	1.9	33.9	1040	0.042	0.023	MDTB_ECOLI Multidrug resistance protein MdtB OS=Escherichia coli (strain K12) OX=83333 GN=mdtB PE=1 SV=1
5	A4IJ58	4.0	32.7	831	0.037	0.025	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
6	O14772	9.3	31.6	607	0.040	0.038	FPGT_HUMAN Fucose-1-phosphate guanylyltransferase OS=Homo sapiens OX=9606 GN=FPGT PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13886 DUF4203	5.1e-37	139.0	Domain of unknown function (DUF4203)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282892	0.764	Mediator of RNA polymerase II transcription subunit 21
2	9606.ENSP00000229395	0.756	FGFR1 oncogene partner 2
3	9606.ENSP00000319918	0.731	T-cell immunomodulatory protein
4	9606.ENSP00000314724	0.692	Liprin-beta-1
5	9606.ENSP00000261191	0.669	Integrator complex subunit 13
6	9606.ENSP00000370671	0.654	Kelch-like protein 42
7	9606.ENSP00000453281	0.630	DNA-binding protein RFX7
8	9606.ENSP00000272748	0.610	Endoplasmic reticulum junction formation protein lunapark
9	9606.ENSP00000281741	0.509	Thioredoxin domain containing 16
10	9606.ENSP00000294304	0.509	Low-density lipoprotein receptor-related protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0050896	0.933	response to stimulus
GO:0048522	0.860	positive regulation of cellular process
GO:0048523	0.838	negative regulation of cellular process
GO:0090087	0.776	regulation of peptide transport
GO:0051716	0.733	cellular response to stimulus
GO:0034620	0.723	cellular response to unfolded protein
GO:0060548	0.653	negative regulation of cell death
GO:0051047	0.633	positive regulation of secretion
GO:0010817	0.593	regulation of hormone levels
GO:1903532	0.592	positive regulation of secretion by cell
GO:0051222	0.592	positive regulation of protein transport
GO:0090276	0.580	regulation of peptide hormone secretion
GO:0050708	0.545	regulation of protein secretion
GO:0043067	0.537	regulation of programmed cell death
GO:0050714	0.528	positive regulation of protein secretion
GO:0043069	0.501	negative regulation of programmed cell death
GO:0050796	0.440	regulation of insulin secretion
GO:0071704	0.346	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0070062	1.000	extracellular exosome
GO:0005737	0.941	cytoplasm
GO:0043231	0.919	intracellular membrane-bounded organelle
GO:0005773	0.381	vacuole
GO:0000323	0.365	lytic vacuole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]