StarFunc result for job id Q9NSA1

User Input

>input (209 residues)
MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAH
LEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA
CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGI
LAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSA1	1.000	1.000	8.709E-40	209	1.000	1.000	Q9NSA1.pdb.gz	FGF21_HUMAN Fibroblast growth factor 21 OS=Homo sapiens OX=9606 GN=FGF21 PE=1 SV=1
2	AFDB:E1BDA6	0.768	0.768	1.494E-32	209	0.847	0.847	E1BDA6.pdb.gz	E1BDA6_BOVIN Fibroblast growth factor OS=Bos taurus OX=9913 GN=FGF21 PE=3 SV=1
3	AFDB:Q9JJN1	0.674	0.671	5.176E-28	210	0.751	0.748	Q9JJN1.pdb.gz	FGF21_MOUSE Fibroblast growth factor 21 OS=Mus musculus OX=10090 GN=Fgf21 PE=1 SV=1
4	AFDB:O95750	0.571	0.553	3.638E-16	216	0.349	0.338	O95750.pdb.gz	FGF19_HUMAN Fibroblast growth factor 19 OS=Homo sapiens OX=9606 GN=FGF19 PE=1 SV=1
5	AFDB:Q8VI82	0.593	0.499	1.628E-14	251	0.335	0.279	Q8VI82.pdb.gz	FGF23_RAT Fibroblast growth factor 23 OS=Rattus norvegicus OX=10116 GN=Fgf23 PE=2 SV=1
6	AFDB:Q9GZV9	0.594	0.499	2.408E-14	251	0.311	0.259	Q9GZV9.pdb.gz	FGF23_HUMAN Fibroblast growth factor 23 OS=Homo sapiens OX=9606 GN=FGF23 PE=1 SV=1
7	AFDB:Q5TLF0	0.565	0.562	2.847E-14	210	0.301	0.300	Q5TLF0.pdb.gz
8	AFDB:O35622	0.577	0.555	4.979E-14	218	0.287	0.275	O35622.pdb.gz	FGF15_MOUSE Fibroblast growth factor 15 OS=Mus musculus OX=10090 GN=Fgf15 PE=1 SV=1
9	AFDB:A0A0R4IU37	0.524	0.561	8.708E-14	194	0.297	0.320	A0A0R4IU37.pdb.gz
10	AFDB:Q1L8M3	0.562	0.463	4.926E-13	258	0.297	0.240	Q1L8M3.pdb.gz
11	PDB:1ry7A	0.509	0.691	5.860E-8	151	0.220	0.305	1ry7A.pdb.gz
12	PDB:3f1rA	0.450	0.590	9.691E-8	157	0.215	0.287	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:4jq0A	0.435	0.628	2.803E-7	141	0.172	0.255	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
14	PDB:6b0tA	0.404	0.182	3.589E-4	487	0.096	0.041	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:3malA	0.388	0.442	1.717E-3	181	0.105	0.122	3malA.pdb.gz
16	PDB:7u9tA	0.377	0.023	2.401E-3	4229	0.110	0.005	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
17	PDB:7t3pA	0.392	0.051	2.539E-3	2066	0.081	0.008	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:7t3qA	0.394	0.050	3.175E-3	2103	0.096	0.010	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7t3rA	0.382	0.049	3.358E-3	2130	0.086	0.008	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:7tzcA	0.425	0.026	3.358E-3	4404	0.115	0.005	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NSA1	4.51e-150	416	209	1.000	1.000	FGF21_HUMAN Fibroblast growth factor 21 OS=Homo sapiens OX=9606 GN=FGF21 PE=1 SV=1
2	E1BDA6	5.29e-115	328	209	0.847	0.847	E1BDA6_BOVIN Fibroblast growth factor OS=Bos taurus OX=9913 GN=FGF21 PE=3 SV=1
3	Q8VI80	6.05e-104	300	208	0.761	0.764	Q8VI80_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf21 PE=3 SV=1
4	Q9JJN1	1.76e-103	299	210	0.751	0.748	FGF21_MOUSE Fibroblast growth factor 21 OS=Mus musculus OX=10090 GN=Fgf21 PE=1 SV=1
5	F7FG05	2.40e-81	243	219	0.603	0.575	F7FG05_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf21 PE=3 SV=1
6	O95750	2.48e-25	100	216	0.373	0.361	FGF19_HUMAN Fibroblast growth factor 19 OS=Homo sapiens OX=9606 GN=FGF19 PE=1 SV=1
7	A0A0R4IN60	5.16e-25	99.0	209	0.287	0.287	A0A0R4IN60_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf19 PE=3 SV=1
8	Q9EPC2	2.95e-23	95.5	251	0.263	0.219	FGF23_MOUSE Fibroblast growth factor 23 OS=Mus musculus OX=10090 GN=Fgf23 PE=1 SV=1
9	Q8VI81	1.91e-21	90.1	218	0.282	0.271	Q8VI81_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf19 PE=2 SV=1
10	O35622	4.98e-21	89.0	218	0.301	0.289	FGF15_MOUSE Fibroblast growth factor 15 OS=Mus musculus OX=10090 GN=Fgf15 PE=1 SV=1
11	Q8VI82	1.65e-20	88.2	251	0.340	0.283	FGF23_RAT Fibroblast growth factor 23 OS=Rattus norvegicus OX=10116 GN=Fgf23 PE=2 SV=1
12	Q1ESX2	7.91e-20	85.1	194	0.273	0.294	Q1ESX2_DANRE Fibroblast growth factor 21 OS=Danio rerio OX=7955 GN=fgf21 PE=2 SV=1
13	Q9GZV9	1.21e-19	85.9	251	0.234	0.195	FGF23_HUMAN Fibroblast growth factor 23 OS=Homo sapiens OX=9606 GN=FGF23 PE=1 SV=1
14	P48805	9.26e-15	71.6	187	0.230	0.257	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
15	Q6PBT8	1.13e-14	70.5	147	0.187	0.265	FGF1_DANRE Putative fibroblast growth factor 1 OS=Danio rerio OX=7955 GN=fgf1 PE=2 SV=1
16	P10767	8.99e-14	69.3	208	0.167	0.168	FGF6_HUMAN Fibroblast growth factor 6 OS=Homo sapiens OX=9606 GN=FGF6 PE=1 SV=4
17	Q8R5L5	1.33e-13	68.9	208	0.172	0.173	Q8R5L5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf6 PE=2 SV=1
18	P21658	1.50e-13	68.6	208	0.172	0.173	FGF6_MOUSE Fibroblast growth factor 6 OS=Mus musculus OX=10090 GN=Fgf6 PE=2 SV=2
19	P08620	1.84e-13	68.6	206	0.220	0.223	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
20	Q9DFC9	3.56e-13	67.4	191	0.206	0.225	Q9DFC9_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fc89b01 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	2.9e-15	67.8	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471477

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393312	0.998	Fibroblast growth factor receptor 1
2	9606.ENSP00000257408	0.994	Beta-klotho
3	9606.ENSP00000078445	0.955	Cyclic AMP-responsive element-binding protein 3-like protein 3
4	9606.ENSP00000373328	0.944	Cell death activator CIDE-3
5	9606.ENSP00000445002	0.933	Apolipoprotein A-V
6	9606.ENSP00000292408	0.929	Fibroblast growth factor receptor 4
7	9606.ENSP00000350425	0.924	Apolipoprotein A-IV
8	9606.ENSP00000466775	0.924	Apolipoprotein C-II
9	9606.ENSP00000339824	0.906	Fibroblast growth factor receptor 3
10	9606.ENSP00000410294	0.890	Fibroblast growth factor receptor 2
11	9606.ENSP00000369442	0.870	Klotho
12	9606.ENSP00000380432	0.824	Insulin
13	9606.ENSP00000385523	0.815	Peroxisome proliferator-activated receptor alpha
14	9606.ENSP00000263923	0.803	Vascular endothelial growth factor receptor 2
15	9606.ENSP00000262999	0.801	Mitochondrial brown fat uncoupling protein 1
16	9606.ENSP00000362570	0.795	Fibronectin type III domain-containing protein 5
17	9606.ENSP00000302665	0.794	Insulin-like growth factor I
18	9606.ENSP00000389814	0.778	Adiponectin
19	9606.ENSP00000282397	0.777	Vascular endothelial growth factor receptor 1
20	9606.ENSP00000288135	0.755	Mast/stem cell growth factor receptor Kit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.992	signaling receptor binding
GO:0098772	0.939	molecular function regulator activity
GO:0140677	0.919	molecular function activator activity
GO:0030545	0.881	signaling receptor regulator activity
GO:0048018	0.839	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0007154	0.982	cell communication
GO:0048522	0.980	positive regulation of cellular process
GO:0023052	0.977	signaling
GO:0051716	0.976	cellular response to stimulus
GO:0007165	0.922	signal transduction
GO:0019222	0.895	regulation of metabolic process
GO:0043410	0.848	positive regulation of MAPK cascade
GO:0009893	0.814	positive regulation of metabolic process
GO:0080090	0.812	regulation of primary metabolic process
GO:0031323	0.778	regulation of cellular metabolic process
GO:0051050	0.773	positive regulation of transport
GO:0031325	0.708	positive regulation of cellular metabolic process
GO:0048519	0.699	negative regulation of biological process
GO:0042221	0.661	response to chemical
GO:0048523	0.576	negative regulation of cellular process
GO:0034764	0.542	positive regulation of transmembrane transport
GO:0060255	0.470	regulation of macromolecule metabolic process
GO:0009719	0.453	response to endogenous stimulus
GO:0007166	0.450	cell surface receptor signaling pathway
GO:0051239	0.448	regulation of multicellular organismal process
GO:0070887	0.446	cellular response to chemical stimulus
GO:0032502	0.429	developmental process
GO:0010827	0.429	regulation of glucose transmembrane transport
GO:0010033	0.413	response to organic substance
GO:0048856	0.410	anatomical structure development
GO:0042127	0.407	regulation of cell population proliferation
GO:0032501	0.351	multicellular organismal process
GO:0010604	0.348	positive regulation of macromolecule metabolic process
GO:0010828	0.348	positive regulation of glucose transmembrane transport
GO:0009605	0.346	response to external stimulus
GO:0051171	0.345	regulation of nitrogen compound metabolic process
GO:0008284	0.343	positive regulation of cell population proliferation
GO:0008152	0.325	metabolic process
GO:0071495	0.324	cellular response to endogenous stimulus
GO:0071704	0.319	organic substance metabolic process
GO:0007167	0.318	enzyme-linked receptor protein signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.785	extracellular space
GO:0005622	0.784	intracellular anatomical structure
GO:0005737	0.739	cytoplasm
GO:0016020	0.406	membrane
GO:0005829	0.372	cytosol
GO:0043226	0.304	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]