StarFunc result for job id Q9NSA3

User Input

>input (81 residues)
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JJN6	0.801	0.801	6.383E-11	81	0.975	0.975	Q9JJN6.pdb.gz	CNBP1_MOUSE Beta-catenin-interacting protein 1 OS=Mus musculus OX=10090 GN=Ctnnbip1 PE=1 SV=1
2	PDB:1lujB	0.668	0.748	8.323E-8	71	0.827	0.944	1lujB.pdb.gz
3	AFDB:P53235	0.350	0.064	5.337E-1	642	0.123	0.016	P53235.pdb.gz	EIF2A_YEAST Eukaryotic translation initiation factor 2A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR054W PE=1 SV=1
4	AFDB:Q9VNX8	0.350	0.056	1.088	638	0.136	0.017	Q9VNX8.pdb.gz	EIF2A_DROME Eukaryotic translation initiation factor 2A OS=Drosophila melanogaster OX=7227 GN=CG7414 PE=1 SV=1
5	AFDB:P40040	0.190	0.103	1.321	218	0.284	0.106	P40040.pdb.gz	THO1_YEAST Protein THO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THO1 PE=1 SV=1
6	AFDB:Q19052	0.379	0.065	1.321	570	0.148	0.021	Q19052.pdb.gz	EIF2A_CAEEL Eukaryotic translation initiation factor 2A OS=Caenorhabditis elegans OX=6239 GN=eif-2A PE=3 SV=2
7	AFDB:K4BIZ9	0.277	0.106	1.604	273	0.198	0.059	K4BIZ9.pdb.gz	WRK70_SOLLC WRKY DNA-binding transcription factor 70 OS=Solanum lycopersicum OX=4081 GN=WRKY70 PE=2 SV=1
8	AFDB:Q9ASQ2	0.215	0.087	1.711	309	0.136	0.036	Q9ASQ2.pdb.gz	MAMYB_ARATH Transcription factor MAMYB OS=Arabidopsis thaliana OX=3702 GN=MAMYB PE=1 SV=1
9	AFDB:Q0WUY5	0.300	0.051	2.523	841	0.160	0.015	Q0WUY5.pdb.gz	Q0WUY5_ARATH Flocculation protein (DUF1296) OS=Arabidopsis thaliana OX=3702 GN=At3g07660 PE=1 SV=1
10	AFDB:Q10289	0.289	0.023	2.523	1842	0.148	0.007	Q10289.pdb.gz	FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fas2 PE=1 SV=2
11	PDB:5e0oA	0.299	0.066	2.662	418	0.074	0.014	5e0oA.pdb.gz	Structure of the trehalose-6-phosphate phosphatase from Brugia malayi reveals key design principles for anthelmintic drugs.
12	AFDB:P07814	0.318	0.042	2.692	1512	0.185	0.010	P07814.pdb.gz	SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5
13	PDB:4iluA	0.300	0.167	4.188	165	0.111	0.055	4iluA.pdb.gz
14	PDB:4agsA	0.187	0.066	4.767	445	0.136	0.025	4agsA.pdb.gz	Leishmania Tdr1 Structure, a Unique Trimeric Glutathione Transferase Capable of Deglutathionylation and Antimonial Prodrug Activation.
15	PDB:4hfqA	0.252	0.134	5.086	203	0.074	0.030	4hfqA.pdb.gz
16	PDB:7m8eF	0.346	0.031	5.086	967	0.086	0.007	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
17	PDB:6vvoE	0.239	0.080	5.426	346	0.099	0.023	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
18	PDB:1hssA	0.270	0.213	5.789	111	0.160	0.117	1hssA.pdb.gz
19	PDB:5z0rB	0.365	0.082	5.789	445	0.099	0.018	5z0rB.pdb.gz	Structural insight into the Zika virus capsid encapsulating the viral genome.
20	PDB:7czeB	0.261	0.210	5.789	109	0.111	0.083	7czeB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NSA3	1.74e-55	167	81	1.000	1.000	CNBP1_HUMAN Beta-catenin-interacting protein 1 OS=Homo sapiens OX=9606 GN=CTNNBIP1 PE=1 SV=1
2	Q9JJN6	1.91e-53	162	81	0.975	0.975	CNBP1_MOUSE Beta-catenin-interacting protein 1 OS=Mus musculus OX=10090 GN=Ctnnbip1 PE=1 SV=1
3	Q8WZA0	9.07e-12	59.3	190	0.395	0.168	LZIC_HUMAN Protein LZIC OS=Homo sapiens OX=9606 GN=LZIC PE=1 SV=1
4	Q5PQN7	2.81e-09	52.8	190	0.383	0.163	LZIC_RAT Protein LZIC OS=Rattus norvegicus OX=10116 GN=Lzic PE=2 SV=1
5	Q6DHH7	7.51e-08	48.9	190	0.333	0.142	LZIC_DANRE Protein LZIC OS=Danio rerio OX=7955 GN=lzic PE=1 SV=1
6	Q93367	1.2	29.3	393	0.247	0.051	MINA1_CAEEL Messenger RNA-binding inhibitor of apoptosis 1 OS=Caenorhabditis elegans OX=6239 GN=mina-1 PE=1 SV=2
7	F4I9K2	2.8	28.5	696	0.136	0.016	F4I9K2_ARATH Aminotransferase-like, plant mobile domain family protein OS=Arabidopsis thaliana OX=3702 GN=At1g51538 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11338 DUF3140	2.8e+02	13.3	Protein of unknown function (DUF3140)
2	PF06384 ICAT	3.2e-20	83.5	Beta-catenin-interacting protein ICAT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362480.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010372596.1	0.999	Catenin beta-1
2	61622.XP_010370488.1	0.979	APC, WNT signaling pathway regulator
3	61622.XP_010373255.1	0.835	APC2, WNT signaling pathway regulator
4	61622.XP_010363553.1	0.791	Uridine-cytidine kinase-like 1 isoform X1
5	61622.XP_010371152.1	0.791	Belongs to the uridine kinase family.
6	61622.XP_010371673.1	0.791	Uridine-cytidine kinase 2
7	61622.XP_010384834.1	0.791	Junction plakoglobin
8	61622.XP_010380148.1	0.788	Axin 1
9	61622.XP_010385394.1	0.763	Belongs to the protein kinase superfamily.
10	61622.XP_010362479.1	0.727	Leucine zipper and CTNNBIP1 domain containing
11	61622.XP_010354222.1	0.705	Homeobox protein Nkx-3.2
12	61622.XP_010381375.1	0.639	Casein kinase 1 alpha 1 like
13	61622.XP_010385162.1	0.639	Belongs to the protein kinase superfamily.
14	61622.XP_010378294.1	0.634	Axin 2
15	61622.XP_010357200.1	0.619	Belongs to the protein kinase superfamily.
16	61622.XP_010366184.1	0.610	Integrin binding sialoprotein
17	61622.XP_010365570.1	0.556	Nicotinamide riboside kinase 2
18	61622.XP_010365571.1	0.556	Caytaxin
19	61622.XP_010387026.1	0.556	Nicotinamide riboside kinase 1
20	61622.XP_010376516.1	0.540	Leucine-rich repeat transmembrane protein FLRT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	1.000	beta-catenin binding
GO:0019904	0.755	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0048523	0.978	negative regulation of cellular process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0050896	0.976	response to stimulus
GO:0048518	0.976	positive regulation of biological process
GO:0044092	0.976	negative regulation of molecular function
GO:0042127	0.976	regulation of cell population proliferation
GO:0032501	0.975	multicellular organismal process
GO:0048522	0.973	positive regulation of cellular process
GO:0051098	0.972	regulation of binding
GO:0045595	0.951	regulation of cell differentiation
GO:0051090	0.946	regulation of DNA-binding transcription factor activity
GO:0048583	0.938	regulation of response to stimulus
GO:0023051	0.920	regulation of signaling
GO:0010646	0.920	regulation of cell communication
GO:0008285	0.920	negative regulation of cell population proliferation
GO:0051100	0.919	negative regulation of binding
GO:0048856	0.915	anatomical structure development
GO:0051253	0.904	negative regulation of RNA metabolic process
GO:0030111	0.877	regulation of Wnt signaling pathway
GO:0060828	0.872	regulation of canonical Wnt signaling pathway
GO:0048731	0.869	system development
GO:0051094	0.860	positive regulation of developmental process
GO:0043433	0.859	negative regulation of DNA-binding transcription factor activity
GO:0023057	0.847	negative regulation of signaling
GO:0010648	0.847	negative regulation of cell communication
GO:0009987	0.824	cellular process
GO:0009890	0.815	negative regulation of biosynthetic process
GO:0048585	0.808	negative regulation of response to stimulus
GO:0060284	0.808	regulation of cell development
GO:0010558	0.806	negative regulation of macromolecule biosynthetic process
GO:0006357	0.806	regulation of transcription by RNA polymerase II
GO:0065008	0.805	regulation of biological quality
GO:0031327	0.805	negative regulation of cellular biosynthetic process
GO:0051239	0.794	regulation of multicellular organismal process
GO:0009968	0.790	negative regulation of signal transduction
GO:0045597	0.786	positive regulation of cell differentiation
GO:0051128	0.778	regulation of cellular component organization
GO:0090090	0.777	negative regulation of canonical Wnt signaling pathway
GO:0048513	0.751	animal organ development
GO:0006950	0.743	response to stress
GO:0045892	0.720	negative regulation of DNA-templated transcription
GO:0006954	0.708	inflammatory response
GO:0009888	0.695	tissue development
GO:0009653	0.673	anatomical structure morphogenesis
GO:0043114	0.624	regulation of vascular permeability
GO:0001763	0.609	morphogenesis of a branching structure
GO:0051101	0.599	regulation of DNA binding
GO:0048754	0.578	branching morphogenesis of an epithelial tube
GO:0002526	0.576	acute inflammatory response
GO:0001823	0.555	mesonephros development
GO:0060675	0.526	ureteric bud morphogenesis
GO:0045667	0.504	regulation of osteoblast differentiation
GO:0001658	0.476	branching involved in ureteric bud morphogenesis
GO:0044087	0.456	regulation of cellular component biogenesis
GO:0051240	0.416	positive regulation of multicellular organismal process
GO:0009893	0.415	positive regulation of metabolic process
GO:0051716	0.396	cellular response to stimulus
GO:0043393	0.389	regulation of protein binding
GO:2000026	0.385	regulation of multicellular organismal development
GO:0010604	0.374	positive regulation of macromolecule metabolic process
GO:0051173	0.372	positive regulation of nitrogen compound metabolic process
GO:0051129	0.364	negative regulation of cellular component organization
GO:0031325	0.345	positive regulation of cellular metabolic process
GO:0010464	0.335	regulation of mesenchymal cell proliferation
GO:0032091	0.330	negative regulation of protein binding
GO:0045639	0.325	positive regulation of myeloid cell differentiation
GO:0048660	0.320	regulation of smooth muscle cell proliferation
GO:1902105	0.316	regulation of leukocyte differentiation
GO:0045669	0.311	positive regulation of osteoblast differentiation
GO:0002763	0.311	positive regulation of myeloid leukocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0005829	0.995	cytosol
GO:0140535	0.969	intracellular protein-containing complex
GO:1902494	0.966	catalytic complex
GO:0030877	0.909	beta-catenin destruction complex
GO:0140513	0.719	nuclear protein-containing complex
GO:0005667	0.706	transcription regulator complex
GO:0016020	0.527	membrane
GO:1990711	0.371	beta-catenin-ICAT complex
GO:0043232	0.352	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]