StarFunc result for job id Q9NSB2

User Input

>input (600 residues)
MSCRSYRVSSGHRVGNFSSCSAMTPQNLNRFRANSVSCWSGPGFRGLGSFGSRSVITFGS
YSPRIAAVGSRPIHCGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGP
GFGYRVGGVGVPAAPSITAVTVNKSLLTPLNLEIDPNAQRVKKDEKEQIKTLNNKFASFI
DKVRFLEQQNKLLETKWSFLQEQKCIRSNLEPLFESYITNLRRQLEVLVSDQARLQAERN
HLQDVLEGFKKKYEEEVVCRANAENEFVALKKDVDAAFMNKSDLEANVDTLTQEIDFLKT
LYMEEIQLLQSHISETSVIVKMDNSRDLNLDGIIAEVKAQYEEVARRSRADAEAWYQTKY
EEMQVTAGQHCDNLRNIRNEINELTRLIQRLKAEIEHAKAQRAKLEAAVAEAEQQGEATL
SDAKCKLADLECALQQAKQDMARQLCEYQELMNAKLGLDIEIATYRRLLEGEESRLCEGV
GPVNISVSSSRGGLVCGPEPLVAGSTLSRGGVTFSGSSSVCATSGVLASCGPSLGGARVA
PATGDLLSTGTRSGSMLISEACVPSVPCPLPTQGGFSSCSGGRSSSVRFVSTTTSCRTKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSB2	1.000	1.000	8.841E-78	600	1.000	1.000	Q9NSB2.pdb.gz	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
2	AFDB:Q99M73	0.624	0.622	2.344E-61	603	0.823	0.819	Q99M73.pdb.gz	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
3	AFDB:Q9NSB4	0.240	0.276	7.879E-34	513	0.508	0.595	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
4	AFDB:Q6PVZ5	0.268	0.269	8.335E-33	599	0.528	0.529	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
5	AFDB:Q14533	0.262	0.308	3.279E-32	505	0.508	0.604	Q14533.pdb.gz	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
6	AFDB:P13647	0.252	0.256	5.585E-32	590	0.527	0.536	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
7	AFDB:P02538	0.249	0.264	2.197E-31	564	0.500	0.532	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
8	AFDB:Q8BGZ7	0.316	0.339	2.197E-31	551	0.477	0.519	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
9	AFDB:Q922U2	0.280	0.288	2.197E-31	580	0.512	0.529	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
10	AFDB:A0A1D5PXP0	0.253	0.289	8.643E-31	522	0.502	0.577	A0A1D5PXP0.pdb.gz
11	PDB:7wooI	0.106	0.324	3.855	187	0.055	0.176	7wooI.pdb.gz
12	PDB:7qooU	0.138	0.340	4.159	186	0.038	0.124	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
13	PDB:6i52A	0.037	0.126	7.085	122	0.015	0.074	6i52A.pdb.gz	A structural and dynamic model for the assembly of Replication Protein A on single-stranded DNA.
14	PDB:3o6qD	0.046	0.459	8.249	44	0.012	0.159	3o6qD.pdb.gz
15	PDB:6ft6u	0.069	0.186	8.249	150	0.020	0.080	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZLV7	0.0	531	487	0.477	0.587	A0A8I5ZLV7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
2	A0A8I6AFC7	0.0	535	488	0.480	0.590	A0A8I6AFC7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
3	A0A8I6G2U8	0.0	527	447	0.447	0.600	A0A8I6G2U8_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
4	A7M776	0.0	560	479	0.485	0.608	A7M776_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
5	O43790	0.0	561	486	0.495	0.611	KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapiens OX=9606 GN=KRT86 PE=1 SV=1
6	P78385	0.0	553	493	0.480	0.584	KRT83_HUMAN Keratin, type II cuticular Hb3 OS=Homo sapiens OX=9606 GN=KRT83 PE=1 SV=2
7	P78386	0.0	595	507	0.538	0.637	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
8	Q14533	0.0	560	505	0.492	0.584	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
9	Q6IG08	0.0	532	555	0.452	0.488	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
10	Q99M73	0.0	918	603	0.817	0.813	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
11	Q9NSB2	0.0	1232	600	1.000	1.000	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
12	Q9NSB4	0.0	552	513	0.475	0.556	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
13	A0A0G2KA07	3.94e-177	514	543	0.437	0.483	A0A0G2KA07_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
14	O95678	1.23e-168	493	551	0.467	0.508	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
15	P02538	6.91e-168	491	564	0.405	0.431	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
16	P50446	1.45e-167	490	553	0.393	0.427	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
17	Q9DCV7	5.20e-167	485	457	0.413	0.543	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
18	P04259	6.97e-167	489	564	0.400	0.426	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
19	P48668	7.36e-167	489	564	0.400	0.426	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
20	P13647	4.61e-165	485	590	0.392	0.398	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20270 CATRA-C	1e+03	11.7	CASPASE and TPR Repeat-Associated C-terminal domain
2	PF10473 CENP-F_leu_zip	6.3	18.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
3	PF16888 DUF5082	22	16.8	Domain of unknown function (DUF5082)
4	PF00038 Filament	1.3e-100	348.6	Intermediate filament protein
5	PF09744 Jnk-SapK_ap_N	7e+02	12.0	JNK_SAPK-associated protein-1
6	PF16208 Keratin_2_head	7.1e-35	132.0	Keratin type II head
7	PF07926 TPR_MLP1_2	4.6e-06	38.1	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257951

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243056	0.628	Homeobox protein Hox-C13
2	9606.ENSP00000333724	0.564	Olfactory receptor 6X1
3	9606.ENSP00000226247	0.550	Forkhead box protein N1
4	9606.ENSP00000330101	0.540	Keratin, type II cytoskeletal 2 oral
5	9606.ENSP00000310861	0.537	Keratin, type II cytoskeletal 2 epidermal
6	9606.ENSP00000252245	0.534	Keratin, type II cytoskeletal 75
7	9606.ENSP00000306261	0.534	Keratin, type II cytoskeletal 78
8	9606.ENSP00000352785	0.532	Desmoglein-4
9	9606.ENSP00000413479	0.532	Keratin, type II cytoskeletal 3
10	9606.ENSP00000307240	0.531	Keratin, type II cytoskeletal 74
11	9606.ENSP00000342710	0.531	Keratin, type II cytoskeletal 1b
12	9606.ENSP00000267119	0.527	Keratin, type II cytoskeletal 71
13	9606.ENSP00000293745	0.527	Keratin, type II cytoskeletal 72
14	9606.ENSP00000369317	0.527	Keratin, type II cytoskeletal 6A
15	9606.ENSP00000378292	0.525	Keratin, type II cytoskeletal 80
16	9606.ENSP00000252252	0.524	Keratin, type II cytoskeletal 6B
17	9606.ENSP00000307014	0.523	Keratin, type II cytoskeletal 73
18	9606.ENSP00000252250	0.521	Keratin, type II cytoskeletal 6C
19	9606.ENSP00000252242	0.518	Keratin, type II cytoskeletal 5
20	9606.ENSP00000328358	0.514	Keratin, type II cytoskeletal 79

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.922	cellular process
GO:0065007	0.837	biological regulation
GO:0050789	0.834	regulation of biological process
GO:0032502	0.726	developmental process
GO:0048856	0.673	anatomical structure development
GO:0050794	0.539	regulation of cellular process
GO:0045682	0.346	regulation of epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0070062	0.999	extracellular exosome
GO:0005882	0.997	intermediate filament
GO:0045095	0.991	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]