StarFunc result for job id Q9NSB4

User Input

>input (513 residues)
MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNV
GFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDE
KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQL
DCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLE
TNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIA
SRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKL
EGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATY
RRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGEL
YVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSB4	1.000	1.000	7.554E-68	513	1.000	1.000	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
2	AFDB:P78386	0.320	0.323	3.100E-33	507	0.604	0.611	P78386.pdb.gz	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
3	AFDB:Q9NSB2	0.276	0.240	5.965E-33	600	0.596	0.510	Q9NSB2.pdb.gz	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
4	AFDB:Q99M73	0.265	0.230	3.177E-32	603	0.604	0.514	Q99M73.pdb.gz	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
5	AFDB:Q14533	0.395	0.401	1.121E-30	505	0.573	0.582	Q14533.pdb.gz	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
6	AFDB:Q6IG08	0.319	0.298	3.953E-29	555	0.550	0.508	Q6IG08.pdb.gz	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
7	AFDB:Q9Z331	0.373	0.349	3.767E-28	562	0.517	0.472	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
8	AFDB:P02538	0.370	0.342	1.500E-27	564	0.511	0.465	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
9	AFDB:Q8BGZ7	0.335	0.315	3.338E-27	551	0.511	0.475	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
10	AFDB:A0A1D5PXP0	0.352	0.347	5.972E-27	522	0.503	0.494	A0A1D5PXP0.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7M776	0.0	533	479	0.569	0.610	A7M776_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
2	O43790	0.0	537	486	0.573	0.605	KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapiens OX=9606 GN=KRT86 PE=1 SV=1
3	P78385	0.0	526	493	0.575	0.598	KRT83_HUMAN Keratin, type II cuticular Hb3 OS=Homo sapiens OX=9606 GN=KRT83 PE=1 SV=2
4	P78386	0.0	567	507	0.591	0.598	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
5	Q14533	0.0	529	505	0.573	0.582	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
6	Q6IG08	0.0	521	555	0.538	0.497	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
7	Q99M73	0.0	563	603	0.610	0.519	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
8	Q9NSB2	0.0	555	600	0.591	0.505	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
9	Q9NSB4	0.0	1051	513	1.000	1.000	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
10	A0A8I6G2U8	1.04e-180	516	447	0.540	0.620	A0A8I6G2U8_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
11	A0A8I6AFC7	6.59e-178	511	488	0.559	0.588	A0A8I6AFC7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
12	A0A8I5ZLV7	2.32e-176	507	487	0.552	0.581	A0A8I5ZLV7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
13	A0A0G2KA07	1.37e-173	502	543	0.519	0.490	A0A0G2KA07_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
14	O95678	6.23e-163	475	551	0.487	0.454	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
15	P50446	7.20e-160	467	553	0.437	0.405	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
16	Q9DCV7	1.23e-159	463	457	0.460	0.516	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
17	Q8BGZ7	1.44e-158	464	551	0.478	0.445	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
18	Q9Z331	1.41e-156	459	562	0.429	0.391	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
19	Q6P6Q2	3.38e-156	459	576	0.425	0.378	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
20	P02538	2.92e-155	456	564	0.429	0.390	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20270 CATRA-C	2.9e+02	13.4	CASPASE and TPR Repeat-Associated C-terminal domain
2	PF00038 Filament	1.3e-95	332.3	Intermediate filament protein
3	PF16208 Keratin_2_head	4e-09	48.2	Keratin type II head
4	PF07926 TPR_MLP1_2	2.9	19.4	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257974

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267119	0.573	Keratin, type II cytoskeletal 71
2	9606.ENSP00000308714	0.570	Olfactory receptor 9Q2
3	9606.ENSP00000257901	0.568	Keratin, type II cuticular Hb5
4	9606.ENSP00000307240	0.553	Keratin, type II cytoskeletal 74
5	9606.ENSP00000252245	0.537	Keratin, type II cytoskeletal 75
6	9606.ENSP00000330101	0.535	Keratin, type II cytoskeletal 2 oral
7	9606.ENSP00000306261	0.532	Keratin, type II cytoskeletal 78
8	9606.ENSP00000332805	0.531	Keratin-associated protein 8-1
9	9606.ENSP00000342710	0.529	Keratin, type II cytoskeletal 1b
10	9606.ENSP00000307014	0.528	Keratin, type II cytoskeletal 73
11	9606.ENSP00000293745	0.526	Keratin, type II cytoskeletal 72
12	9606.ENSP00000310861	0.526	Keratin, type II cytoskeletal 2 epidermal
13	9606.ENSP00000335565	0.525	Keratin-associated protein 10-8
14	9606.ENSP00000377558	0.525	Keratin, type I cuticular Ha5
15	9606.ENSP00000328358	0.523	Keratin, type II cytoskeletal 79
16	9606.ENSP00000369317	0.523	Keratin, type II cytoskeletal 6A
17	9606.ENSP00000413479	0.523	Keratin, type II cytoskeletal 3
18	9606.ENSP00000372286	0.522	Keratin-associated protein 27-1
19	9606.ENSP00000252250	0.520	Keratin, type II cytoskeletal 6C
20	9606.ENSP00000378292	0.520	Keratin, type II cytoskeletal 80

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.963	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0045103	0.975	intermediate filament-based process
GO:0032502	0.855	developmental process
GO:0048856	0.681	anatomical structure development
GO:0008544	0.427	epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0005882	0.995	intermediate filament
GO:0045095	0.985	keratin filament
GO:0005576	0.973	extracellular region
GO:0005615	0.890	extracellular space
GO:0031982	0.761	vesicle
GO:0043230	0.625	extracellular organelle
GO:0070062	0.624	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]