StarFunc result for job id Q9NSB8

User Input

>input (354 residues)
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEIN
REKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88801	0.937	0.937	1.052E-45	354	0.952	0.952	O88801.pdb.gz	HOME2_RAT Homer protein homolog 2 OS=Rattus norvegicus OX=10116 GN=Homer2 PE=1 SV=1
2	AFDB:B0JZL8	0.358	0.362	1.778E-36	350	0.667	0.674	B0JZL8.pdb.gz
3	AFDB:Q502P2	0.360	0.403	8.234E-33	314	0.602	0.678	Q502P2.pdb.gz	Q502P2_DANRE Homer protein homolog 2 OS=Danio rerio OX=7955 GN=zgc:111960 PE=1 SV=1
4	AFDB:Q9Z214	0.441	0.428	2.394E-29	366	0.520	0.503	Q9Z214.pdb.gz	HOME1_RAT Homer protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Homer1 PE=1 SV=2
5	AFDB:B8JIC5	0.375	0.338	4.149E-28	398	0.511	0.455	B8JIC5.pdb.gz	B8JIC5_DANRE Homer protein homolog 1 isoform 1 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
6	AFDB:Q99JP6	0.348	0.347	5.070E-27	356	0.449	0.447	Q99JP6.pdb.gz	HOME3_MOUSE Homer protein homolog 3 OS=Mus musculus OX=10090 GN=Homer3 PE=1 SV=2
7	AFDB:Q9NSC5	0.357	0.350	6.038E-27	361	0.449	0.440	Q9NSC5.pdb.gz	HOME3_HUMAN Homer protein homolog 3 OS=Homo sapiens OX=9606 GN=HOMER3 PE=1 SV=2
8	AFDB:M9PEX1	0.327	0.290	1.813E-24	400	0.444	0.393	M9PEX1.pdb.gz	M9PEX1_DROME Homer, isoform G OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
9	AFDB:Q03173	0.301	0.141	1.124E-11	802	0.192	0.085	Q03173.pdb.gz	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
10	AFDB:A0A0U1RRM6	0.301	0.141	4.817E-11	802	0.198	0.087	A0A0U1RRM6.pdb.gz	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
11	PDB:1k5dB	0.278	0.642	6.581E-7	146	0.068	0.164	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
12	PDB:3m1iB	0.280	0.714	8.804E-7	131	0.076	0.206	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
13	PDB:1q67B	0.245	0.501	9.516E-4	161	0.054	0.118	1q67B.pdb.gz
14	PDB:6am0F	0.248	0.465	3.048E-3	178	0.048	0.096	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
15	PDB:2qkmG	0.239	0.594	5.147E-3	127	0.056	0.157	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
16	PDB:4gouA	0.199	0.146	7.737E-3	507	0.040	0.028	4gouA.pdb.gz
17	PDB:6oxlN	0.231	0.538	8.201E-3	124	0.051	0.145	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
18	PDB:4mk0A	0.236	0.141	9.213E-3	631	0.042	0.024	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:7rx9A	0.202	0.169	1.163E-2	432	0.042	0.035	7rx9A.pdb.gz
20	PDB:2kr0A	0.202	0.178	1.468E-2	407	0.025	0.022	2kr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88801	0.0	696	354	0.952	0.952	HOME2_RAT Homer protein homolog 2 OS=Rattus norvegicus OX=10116 GN=Homer2 PE=1 SV=1
2	Q9NSB8	0.0	728	354	1.000	1.000	HOME2_HUMAN Homer protein homolog 2 OS=Homo sapiens OX=9606 GN=HOMER2 PE=1 SV=1
3	Q9QWW1	0.0	690	354	0.944	0.944	HOME2_MOUSE Homer protein homolog 2 OS=Mus musculus OX=10090 GN=Homer2 PE=1 SV=1
4	Q502P2	6.55e-149	424	314	0.602	0.678	Q502P2_DANRE Homer protein homolog 2 OS=Danio rerio OX=7955 GN=zgc:111960 PE=1 SV=1
5	A0A0R4INT7	1.85e-121	356	360	0.534	0.525	A0A0R4INT7_DANRE Homer protein homolog 1 isoform 2 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
6	Q9Z214	1.90e-119	351	366	0.534	0.516	HOME1_RAT Homer protein homolog 1 OS=Rattus norvegicus OX=10116 GN=Homer1 PE=1 SV=2
7	Q9Z2Y3	4.70e-119	350	366	0.531	0.514	HOME1_MOUSE Homer protein homolog 1 OS=Mus musculus OX=10090 GN=Homer1 PE=1 SV=2
8	B8JIC5	2.37e-118	349	398	0.528	0.470	B8JIC5_DANRE Homer protein homolog 1 isoform 1 OS=Danio rerio OX=7955 GN=homer1 PE=3 SV=1
9	Q86YM7	1.73e-115	340	354	0.525	0.525	HOME1_HUMAN Homer protein homolog 1 OS=Homo sapiens OX=9606 GN=HOMER1 PE=1 SV=2
10	Q99JP6	1.11e-99	300	356	0.460	0.458	HOME3_MOUSE Homer protein homolog 3 OS=Mus musculus OX=10090 GN=Homer3 PE=1 SV=2
11	Q9NSC5	3.81e-95	289	361	0.455	0.446	HOME3_HUMAN Homer protein homolog 3 OS=Homo sapiens OX=9606 GN=HOMER3 PE=1 SV=2
12	O96607	9.80e-84	261	394	0.438	0.393	O96607_DROME Homer OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
13	Q0E8S7	1.80e-82	262	531	0.438	0.292	Q0E8S7_DROME Homer, isoform E OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=2
14	M9PB54	7.13e-82	256	397	0.432	0.385	M9PB54_DROME Homer, isoform F OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
15	M9PEX1	8.48e-82	256	400	0.432	0.383	M9PEX1_DROME Homer, isoform G OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
16	Q9VM94	1.65e-81	255	397	0.432	0.385	Q9VM94_DROME Homer, isoform B OS=Drosophila melanogaster OX=7227 GN=homer PE=1 SV=1
17	Q5TJ65	8.09e-10	62.0	380	0.096	0.089	VASP_DICDI Protein VASP homolog OS=Dictyostelium discoideum OX=44689 GN=vasp PE=1 SV=1
18	Q9UI08	4.61e-09	59.7	416	0.090	0.077	EVL_HUMAN Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL PE=1 SV=2
19	P70429	2.55e-08	57.4	414	0.088	0.075	EVL_MOUSE Ena/VASP-like protein OS=Mus musculus OX=10090 GN=Evl PE=1 SV=2
20	O08719	3.56e-08	57.0	420	0.088	0.074	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05667 CCDC22	13	16.1	Coiled-coil domain-containing protein 22
2	PF10473 CENP-F_leu_zip	10	17.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
3	PF16526 CLZ	8.4e+02	11.8	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
4	PF09727 CortBP2	4.8e+02	12.1	Cortactin-binding protein-2
5	PF19220 Crescentin	4.6e+02	11.2	Crescentin protein
6	PF08826 DMPK_coil	41	15.7	DMPK coiled coil domain like
7	PF06818 Fez1	5.1e+02	12.5	Fez1
8	PF05377 FlaC_arch	8.7	18.1	Flagella accessory protein C (FlaC)
9	PF13851 GAS	1.7e+02	13.0	Growth-arrest specific micro-tubule binding
10	PF09726 Macoilin	0.072	23.3	Macoilin family
11	PF05557 MAD	10	16.0	Mitotic checkpoint protein
12	PF06810 Phage_GP20	49	15.2	Phage minor structural protein GP20
13	PF15233 SYCE1	21	16.6	Synaptonemal complex central element protein 1
14	PF04871 Uso1_p115_C	2.7e+02	13.2	Uso1 / p115 like vesicle tethering protein, C terminal region
15	PF00568 WH1	3.9e-32	121.9	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305632

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334382	0.976	Homer protein homolog 1
2	9606.ENSP00000383118	0.971	Cell division control protein 42 homolog
3	9606.ENSP00000354896	0.968	Metabotropic glutamate receptor 1
4	9606.ENSP00000293441	0.952	SH3 and multiple ankyrin repeat domains protein 1
5	9606.ENSP00000439937	0.942	Homer protein homolog 3
6	9606.ENSP00000306138	0.938	Metabotropic glutamate receptor 5
7	9606.ENSP00000469689	0.929	SH3 and multiple ankyrin repeat domains protein 2
8	9606.ENSP00000306253	0.841	Inositol 1,4,5-trisphosphate receptor type 1
9	9606.ENSP00000382428	0.834	Disks large homolog 4
10	9606.ENSP00000316377	0.823	Disks large-associated protein 1
11	9606.ENSP00000292385	0.808	Drebrin
12	9606.ENSP00000264538	0.742	Intraflagellar transport protein 57 homolog
13	9606.ENSP00000342755	0.732	E3 ubiquitin-protein ligase NRDP1
14	9606.ENSP00000477455	0.732	Glutamate receptor ionotropic, NMDA 2B
15	9606.ENSP00000363480	0.722	Disks large homolog 3
16	9606.ENSP00000365272	0.720	Disks large homolog 2
17	9606.ENSP00000392500	0.698	Neuroligin-1
18	9606.ENSP00000362444	0.694	Disks large-associated protein 3
19	9606.ENSP00000351591	0.691	Neuroligin-3
20	9606.ENSP00000385142	0.686	Neurexin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.970	signaling receptor binding
GO:0044877	0.967	protein-containing complex binding
GO:0019904	0.935	protein domain specific binding
GO:0042802	0.893	identical protein binding
GO:0035254	0.854	glutamate receptor binding
GO:0001664	0.844	G protein-coupled receptor binding
GO:0035256	0.542	G protein-coupled glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007166	0.996	cell surface receptor signaling pathway
GO:0032501	0.995	multicellular organismal process
GO:0023051	0.994	regulation of signaling
GO:0007215	0.994	glutamate receptor signaling pathway
GO:0003008	0.989	system process
GO:0048583	0.985	regulation of response to stimulus
GO:0010646	0.982	regulation of cell communication
GO:0050954	0.969	sensory perception of mechanical stimulus
GO:0009966	0.962	regulation of signal transduction
GO:0007186	0.945	G protein-coupled receptor signaling pathway
GO:0007605	0.861	sensory perception of sound
GO:0019222	0.691	regulation of metabolic process
GO:1902531	0.674	regulation of intracellular signal transduction
GO:0050848	0.631	regulation of calcium-mediated signaling
GO:0060255	0.621	regulation of macromolecule metabolic process
GO:0048519	0.595	negative regulation of biological process
GO:0048518	0.419	positive regulation of biological process
GO:0051239	0.399	regulation of multicellular organismal process
GO:0070884	0.337	regulation of calcineurin-NFAT signaling cascade
GO:0032663	0.312	regulation of interleukin-2 production
GO:0048523	0.308	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.999	cytoplasm
GO:0005886	0.988	plasma membrane
GO:0042995	0.983	cell projection
GO:0005829	0.979	cytosol
GO:0120025	0.974	plasma membrane bounded cell projection
GO:0043229	0.961	intracellular organelle
GO:0043005	0.932	neuron projection
GO:0045202	0.861	synapse
GO:0043227	0.838	membrane-bounded organelle
GO:0043231	0.810	intracellular membrane-bounded organelle
GO:0030425	0.741	dendrite
GO:0098794	0.462	postsynapse
GO:0043025	0.368	neuronal cell body
GO:0005634	0.356	nucleus
GO:0043232	0.336	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]