StarFunc result for job id Q9NSC2

User Input

>input (1324 residues)
MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLLL
HKKNCTKNQLVLIVNENPASPPETFSPSPPPDNPDEQMNDTVNKTDQVDCSDLSEHNGLD
REESMEVEAPVANKSGSGTSSGSHSSTAPSSSSSSSSSSGGGGSSSTGTSAITTSLPQLG
DLTTLGNFSVINSNVIIENLQSTKVAVAQFSQEARCGGASGGKLAVPALMEQLLALQQQQ
IHQLQLIEQIRHQILLLASQNADLPTSSSPSQGTLRTSANPLSTLSSHLSQQLAAAAGLA
QSLASQSASISGVKQLPPIQLPQSSSGNTIIPSNSGSSPNMNILAAAVTTPSSEKVASSA
GASHVSNPAVSSSSSPAFAISSLLSPASNPLLPQQASANSVFPSPLPNIGTTAEDLNSLS
ALAQQRKSKPPNVTAFEAKSTSDEAFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCN
ICGNRFSTKGNLKVHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSIPPEKPVTS
WLDTKPVLPTLTTSVGLPLPPTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPES
ATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAGSATTFTN
PLLPLMSEQFKAKFPFGGLLDSAQASETSKLQQLVENIDKKATDPNECIICHRVLSCQSA
LKMHYRTHTGERPFKCKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPICQKKFTNAVV
LQQHIRMHMGGQIPNTPVPDSYSESMESDTGSFDEKNFDDLDNFSDENMEDCPEGSIPDT
PKSADASQDSLSSSPLPLEMSSIAALENQMKMINAGLAEQLQASLKSVENGSIEGDVLTN
DSSSVGGDMESQSAGSPAISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGL
SPTPVNGGALDLTSSHAEKIIKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHY
RSHTKERPFICTVCNRGFSTKGNLKQHMLTHQMRDLPSQLFEPSSNLGPNQNSAVIPANS
LSSLIKTEVNGFVHVSPQDSKDTPTSHVPSGPLSSSATSPVLLPALPRRTPKQHYCNTCG
KTFSSSSALQIHERTHTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSTPARRGRRLSVD
GPMTFLGGNPVKFPEMFQKDLAARSGSGDPSSFWNQYAAALSNGLAMKANEISVIQNGGI
PPIPGSLGSGNSSPVSGLTGNLERLQNSEPNAPLAGLEKMASSENGTNFRFTRFVEDSKE
IVTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QI36	0.461	0.464	0.000	1313	0.690	0.695	F1QI36.pdb.gz	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
2	AFDB:Q9NSC2	0.999	0.999	0.000	1324	1.000	1.000	Q9NSC2.pdb.gz	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
3	AFDB:Q62255	0.332	0.332	2.403E-101	1320	0.539	0.541	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
4	AFDB:Q90ZW5	0.094	0.098	9.910E-87	1261	0.511	0.537	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
5	AFDB:B0LVF0	0.057	0.061	1.291E-12	1219	0.155	0.168	B0LVF0.pdb.gz	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
6	AFDB:A0A2R8QDL5	0.048	0.053	3.192E-11	1191	0.138	0.154	A0A2R8QDL5.pdb.gz
7	AFDB:Q9VXJ5	0.050	0.050	5.083E-10	1311	0.162	0.163	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
8	AFDB:F1QMZ5	0.048	0.052	4.423E-8	1190	0.135	0.150	F1QMZ5.pdb.gz	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
9	AFDB:B7ZRU9	0.062	0.076	1.002E-7	1055	0.109	0.136	B7ZRU9.pdb.gz	EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis OX=8355 GN=mecom-a PE=1 SV=1
10	AFDB:D4A0R1	0.050	0.055	6.366E-6	1090	0.113	0.138	D4A0R1.pdb.gz	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
11	PDB:3w5kB	0.031	0.210	9.106E-3	110	0.021	0.255	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6n8jb	0.024	0.039	3.818	647	0.013	0.026	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
13	PDB:7oniR	0.025	0.213	3.818	86	0.005	0.070	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:5gm6a	0.025	0.107	4.066	123	0.010	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7pmkQ	0.018	0.026	4.911	766	0.009	0.016	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:7pt6I	0.022	0.058	4.911	341	0.018	0.070	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
17	PDB:7abiP	0.028	0.092	5.569	237	0.008	0.046	7abiP.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
18	PDB:7edxH	0.022	0.079	5.569	209	0.019	0.120	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
19	PDB:7d58L	0.015	0.294	5.931	47	0.006	0.170	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
20	PDB:6htsR	0.022	0.289	7.163	72	0.006	0.111	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5NSE4	0.0	1532	1217	0.644	0.701	A0A1D5NSE4_DANRE Sal-like protein 1 isoform X1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
2	F1QI36	0.0	1662	1313	0.695	0.701	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
3	Q62255	0.0	1189	1320	0.550	0.552	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
4	Q6P5E3	0.0	2298	1323	0.903	0.903	Q6P5E3_MOUSE Sal-like 1 (Drosophila) OS=Mus musculus OX=10090 GN=Sall1 PE=1 SV=1
5	Q90ZW5	0.0	827	1261	0.404	0.424	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
6	Q9DF77	0.0	2207	1308	0.865	0.875	Q9DF77_CHICK Spalt 1 OS=Gallus gallus OX=9031 GN=SAL1 PE=1 SV=1
7	Q9ER74	0.0	2321	1322	0.900	0.902	SALL1_MOUSE Sal-like protein 1 OS=Mus musculus OX=10090 GN=Sall1 PE=1 SV=1
8	Q9NSC2	0.0	2695	1324	1.000	1.000	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
9	A0MWC1	1.92e-176	554	1091	0.324	0.393	A0MWC1_DANRE Sal-like protein 4 OS=Danio rerio OX=7955 GN=sb:cb372 PE=1 SV=1
10	Q9UJQ4	1.22e-156	501	1053	0.323	0.406	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
11	Q8BX22	6.17e-115	388	1067	0.200	0.248	SALL4_MOUSE Sal-like protein 4 OS=Mus musculus OX=10090 GN=Sall4 PE=1 SV=2
12	Q9QX96	1.00e-104	358	1004	0.191	0.252	SALL2_MOUSE Sal-like protein 2 OS=Mus musculus OX=10090 GN=Sall2 PE=1 SV=2
13	Q9Y467	2.94e-99	343	1007	0.144	0.190	SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens OX=9606 GN=SALL2 PE=1 SV=4
14	Q5U0U1	3.58e-74	273	1267	0.119	0.125	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
15	Q9VKH3	3.71e-74	273	1267	0.119	0.125	Q9VKH3_DROME FI23031p1 OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
16	Q5U0U8	4.38e-73	270	1267	0.119	0.124	Q5U0U8_DROME AT24316p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
17	P91639	1.29e-72	268	1263	0.118	0.124	P91639_DROME Spalt-related protein OS=Drosophila melanogaster OX=7227 GN=salr PE=4 SV=1
18	Q6Y8G5	5.42e-54	192	276	0.083	0.399	Q6Y8G5_HUMAN SALL4C OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
19	P39770	1.67e-43	176	1365	0.054	0.053	SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster OX=7227 GN=salm PE=1 SV=3
20	G5EFF4	9.17e-29	127	744	0.051	0.090	SEM4_CAEEL Spalt-like protein sem-4 OS=Caenorhabditis elegans OX=6239 GN=sem-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	5.8e+02	12.3	BolA-like protein
2	PF11672 DUF3268	6.5	18.5	zinc-finger-containing domain
3	PF15005 IZUMO	21	17.1	Izumo sperm-egg fusion, Ig domain-associated
4	PF00096 zf-C2H2	8.7e-31	115.8	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	1.3	20.8	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	1.7e-29	110.9	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	3.8e-08	44.4	C2H2-type zinc finger
8	PF16293 zf-C2H2_9	1.9e+02	13.3	C2H2 type zinc-finger (1 copy)
9	PF12171 zf-C2H2_jaz	1.3e-21	87.5	Zinc-finger double-stranded RNA-binding
10	PF13913 zf-C2HC_2	0.62	21.3	zinc-finger of a C2HC-type
11	PF16278 zf-C2HE	41	16.1	C2HE / C2H2 / C2HC zinc-binding finger
12	PF05605 zf-Di19	3.8	19.2	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	6.1e-20	81.9	Zinc-finger double domain
14	PF12874 zf-met	2.3e-20	83.5	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251020

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229307	0.993	Homeobox protein NANOG
2	9606.ENSP00000259915	0.979	POU domain, class 5, transcription factor 1
3	9606.ENSP00000323588	0.974	Transcription factor SOX-2
4	9606.ENSP00000217086	0.930	Sal-like protein 4
5	9606.ENSP00000372351	0.830	Histone-lysine N-methyltransferase NSD2
6	9606.ENSP00000344456	0.810	Catenin beta-1
7	9606.ENSP00000304502	0.805	Homeobox protein SIX2
8	9606.ENSP00000247182	0.790	Homeobox protein SIX1
9	9606.ENSP00000276603	0.769	Telomeric repeat-binding factor 1
10	9606.ENSP00000402949	0.768	Cyclin-Q
11	9606.ENSP00000342626	0.731	Eyes absent homolog 1
12	9606.ENSP00000359319	0.722	Paired box protein Pax-2
13	9606.ENSP00000376553	0.677	Transmembrane protein 119
14	9606.ENSP00000320949	0.659	CCR4-NOT transcription complex subunit 1
15	9606.ENSP00000386759	0.653	Histone-lysine N-methyltransferase SETD2
16	9606.ENSP00000371875	0.649	Homeobox protein Nkx-3.2
17	9606.ENSP00000477829	0.606	LIM/homeobox protein Lhx1
18	9606.ENSP00000348056	0.581	SUMO-conjugating enzyme UBC9
19	9606.ENSP00000268459	0.577	Protein naked cuticle homolog 1
20	9606.ENSP00000327758	0.576	Homeobox protein Nkx-2.5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008013	0.930	beta-catenin binding
GO:1901363	0.861	heterocyclic compound binding
GO:0097159	0.859	organic cyclic compound binding
GO:0003676	0.841	nucleic acid binding
GO:0140110	0.840	transcription regulator activity
GO:0003677	0.832	DNA binding
GO:0043565	0.801	sequence-specific DNA binding
GO:0003700	0.800	DNA-binding transcription factor activity
GO:1990837	0.789	sequence-specific double-stranded DNA binding
GO:0000976	0.777	transcription cis-regulatory region binding
GO:0000981	0.605	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.541	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0032501	0.989	multicellular organismal process
GO:0032502	0.988	developmental process
GO:0019222	0.985	regulation of metabolic process
GO:0048856	0.983	anatomical structure development
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0031323	0.982	regulation of cellular metabolic process
GO:0080090	0.981	regulation of primary metabolic process
GO:0010468	0.978	regulation of gene expression
GO:0007275	0.974	multicellular organism development
GO:0048518	0.966	positive regulation of biological process
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0048519	0.961	negative regulation of biological process
GO:0048522	0.942	positive regulation of cellular process
GO:0051252	0.923	regulation of RNA metabolic process
GO:0048523	0.921	negative regulation of cellular process
GO:0009987	0.919	cellular process
GO:0006355	0.909	regulation of DNA-templated transcription
GO:0006357	0.879	regulation of transcription by RNA polymerase II
GO:0009653	0.852	anatomical structure morphogenesis
GO:0009892	0.851	negative regulation of metabolic process
GO:0010605	0.842	negative regulation of macromolecule metabolic process
GO:0031324	0.832	negative regulation of cellular metabolic process
GO:0051172	0.831	negative regulation of nitrogen compound metabolic process
GO:0045934	0.819	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.806	negative regulation of macromolecule biosynthetic process
GO:0031327	0.806	negative regulation of cellular biosynthetic process
GO:0000122	0.778	negative regulation of transcription by RNA polymerase II
GO:0048583	0.743	regulation of response to stimulus
GO:0010646	0.735	regulation of cell communication
GO:0048731	0.704	system development
GO:0009893	0.675	positive regulation of metabolic process
GO:0009966	0.652	regulation of signal transduction
GO:0048513	0.638	animal organ development
GO:0031325	0.621	positive regulation of cellular metabolic process
GO:0010604	0.611	positive regulation of macromolecule metabolic process
GO:0051173	0.602	positive regulation of nitrogen compound metabolic process
GO:0045935	0.592	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.589	positive regulation of biosynthetic process
GO:0051254	0.572	positive regulation of RNA metabolic process
GO:0031328	0.559	positive regulation of cellular biosynthetic process
GO:0010557	0.558	positive regulation of macromolecule biosynthetic process
GO:0045893	0.554	positive regulation of DNA-templated transcription
GO:0048736	0.549	appendage development
GO:0030154	0.431	cell differentiation
GO:0045944	0.399	positive regulation of transcription by RNA polymerase II
GO:0060173	0.367	limb development
GO:0050896	0.365	response to stimulus
GO:0048598	0.342	embryonic morphogenesis
GO:0009888	0.325	tissue development
GO:0007399	0.321	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0000785	0.758	chromatin
GO:0005737	0.654	cytoplasm
GO:0000792	0.427	heterochromatin
GO:0032991	0.359	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]