StarFunc result for job id Q9NSC7

User Input

>input (600 residues)
MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLA
KPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQ
RAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTV
SEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPF
QSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPN
LTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSL
RCITCAVVGNGGILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQ
SLLILGNRGFKNVPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFR
EALHMDRYLLLHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYG
FITEGHERFSDHYYDTSWKRLIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSC7	1.000	1.000	0.000	600	1.000	1.000	Q9NSC7.pdb.gz	SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=1 SV=1
2	PDB:6aplC	0.469	0.899	1.599E-32	306	0.218	0.428	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
3	PDB:4fgwA	0.079	0.123	5.312E-2	353	0.020	0.034	4fgwA.pdb.gz
4	AFDB:D3Z4R1	0.094	0.053	1.094E-1	1434	0.092	0.038	D3Z4R1.pdb.gz	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
5	AFDB:Q9I920	0.094	0.058	2.333E-1	1183	0.115	0.058	Q9I920.pdb.gz	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2
6	PDB:1kl7A	0.071	0.080	4.855E-1	509	0.047	0.055	1kl7A.pdb.gz	Structure and function of threonine synthase from yeast.
7	AFDB:F6VJC5	0.065	0.055	4.974E-1	765	0.120	0.094	F6VJC5.pdb.gz	F6VJC5_MOUSE Sec24 related gene family, member B (S. cerevisiae) (Fragment) OS=Mus musculus OX=10090 GN=Sec24b PE=1 SV=1
8	PDB:6em8A	0.103	0.088	5.781E-1	744	0.037	0.030	6em8A.pdb.gz
9	AFDB:Q9GV71	0.091	0.050	6.278E-1	1543	0.113	0.044	Q9GV71.pdb.gz	Q9GV71_DICDI MAP kinase phosphatase OS=Dictyostelium discoideum OX=44689 GN=mkpA PE=4 SV=1
10	PDB:2i2xB	0.088	0.151	7.297E-1	258	0.027	0.062	2i2xB.pdb.gz	Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
11	PDB:7epmA	0.098	0.146	7.297E-1	335	0.023	0.042	7epmA.pdb.gz	Identification of human LDHC4 as a potential target for anticancer drug discovery.
12	AFDB:Q8BPY9	0.068	0.064	7.476E-1	683	0.107	0.094	Q8BPY9.pdb.gz	FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus OX=10090 GN=Fignl1 PE=1 SV=1
13	PDB:1vb3A	0.078	0.094	7.735E-1	428	0.042	0.058	1vb3A.pdb.gz	Crystal Structure of Threonine Synthase from Escherichia coli
14	PDB:4eacC	0.111	0.153	7.735E-1	396	0.040	0.061	4eacC.pdb.gz	Structural insights into decreased enzymatic activity induced by an insert sequence in mannonate dehydratase from Gram negative bacterium.
15	AFDB:Q9FNM7	0.136	0.106	8.399E-1	850	0.100	0.071	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
16	PDB:5wp4A	0.072	0.085	8.690E-1	485	0.035	0.043	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
17	PDB:2c59A	0.066	0.092	9.211E-1	364	0.027	0.044	2c59A.pdb.gz	Structure and Function of Gdp-Mannose-3',5'-Epimerase: An Enzyme which Performs Three Chemical Reactions at the Same Active Site.
18	AFDB:D4AIA8	0.110	0.093	1.338	784	0.105	0.080	D4AIA8.pdb.gz	D4AIA8_ASPOZ AAA ATPase OS=Aspergillus oryzae OX=5062 GN=aipA PE=4 SV=1
19	AFDB:P87323	0.074	0.081	1.419	522	0.097	0.111	P87323.pdb.gz	MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcs4 PE=4 SV=1
20	AFDB:Q8JIG3	0.063	0.048	1.594	845	0.080	0.057	Q8JIG3.pdb.gz	Q8JIG3_DANRE BHLH-PAS transcription factor OS=Danio rerio OX=7955 GN=zfCLOCK2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NSC7	0.0	1250	600	1.000	1.000	SIA7A_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=1 SV=1
2	Q9QZ39	0.0	649	526	0.555	0.633	SIA7A_MOUSE Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St6galnac1 PE=1 SV=2
3	Q92183	3.54e-170	497	566	0.387	0.410	SIA7A_CHICK Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Gallus gallus OX=9031 GN=ST6GALNAC1 PE=1 SV=1
4	Q9UJ37	7.59e-77	250	374	0.227	0.364	SIA7B_HUMAN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST6GALNAC2 PE=1 SV=1
5	Q7T2X4	1.33e-69	234	446	0.230	0.309	Q7T2X4_ONCMY GalNAc alpha 2,6-sialyltransferase OS=Oncorhynchus mykiss OX=8022 GN=rtST6GalNAc PE=2 SV=1
6	Q11203	4.06e-21	97.8	375	0.138	0.221	SIAT6_HUMAN CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL3 PE=1 SV=1
7	P97325	2.48e-20	95.5	374	0.137	0.219	SIAT6_MOUSE CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Mus musculus OX=10090 GN=St3gal3 PE=1 SV=2
8	Q02734	2.51e-20	95.5	374	0.137	0.219	SIAT6_RAT CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase OS=Rattus norvegicus OX=10116 GN=St3gal3 PE=1 SV=1
9	Q11201	7.38e-18	87.4	340	0.113	0.200	SIA4A_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST3GAL1 PE=1 SV=1
10	Q8QH83	9.39e-18	87.8	381	0.120	0.189	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
11	Q8K4T1	7.05e-17	85.1	398	0.115	0.173	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
12	Q02745	9.40e-17	84.3	343	0.117	0.204	SIA4A_PIG CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Sus scrofa OX=9823 GN=ST3GAL1 PE=1 SV=1
13	Q11206	4.61e-16	82.0	333	0.110	0.198	SIA4C_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Homo sapiens OX=9606 GN=ST3GAL4 PE=1 SV=1
14	Q11205	6.24e-16	81.6	350	0.097	0.166	SIA4B_RAT CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Rattus norvegicus OX=10116 GN=St3gal2 PE=1 SV=1
15	Q11204	7.63e-16	81.6	350	0.097	0.166	SIA4B_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Mus musculus OX=10090 GN=St3gal2 PE=1 SV=2
16	Q16842	2.58e-15	80.1	350	0.095	0.163	SIA4B_HUMAN CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 OS=Homo sapiens OX=9606 GN=ST3GAL2 PE=1 SV=1
17	Q91Y74	3.43e-15	79.3	333	0.105	0.189	SIA4C_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 OS=Mus musculus OX=10090 GN=St3gal4 PE=1 SV=1
18	P54751	4.42e-15	79.0	337	0.093	0.166	SIA4A_MOUSE CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 OS=Mus musculus OX=10090 GN=St3gal1 PE=1 SV=1
19	Q9UNP4	6.15e-15	79.3	418	0.123	0.177	SIAT9_HUMAN Lactosylceramide alpha-2,3-sialyltransferase OS=Homo sapiens OX=9606 GN=ST3GAL5 PE=1 SV=4
20	Q64689	6.39e-15	79.0	380	0.123	0.195	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	2.7e-77	271.6	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000156626

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389176	0.981	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
2	9606.ENSP00000304364	0.978	C1GALT1-specific chaperone 1
3	9606.ENSP00000415454	0.965	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
4	9606.ENSP00000484640	0.961	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
5	9606.ENSP00000428540	0.931	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
6	9606.ENSP00000377257	0.922	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
7	9606.ENSP00000364150	0.872	Polypeptide N-acetylgalactosaminyltransferase 12
8	9606.ENSP00000444171	0.845	Polypeptide N-acetylgalactosaminyltransferase 6
9	9606.ENSP00000436604	0.831	Polypeptide N-acetylgalactosaminyltransferase 4
10	9606.ENSP00000329214	0.809	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3
11	9606.ENSP00000217182	0.802	Elongation factor 1-alpha 2
12	9606.ENSP00000252318	0.789	Probable polypeptide N-acetylgalactosaminyltransferase 8
13	9606.ENSP00000376465	0.785	Polypeptide N-acetylgalactosaminyltransferase 3
14	9606.ENSP00000269195	0.781	Polypeptide N-acetylgalactosaminyltransferase 1
15	9606.ENSP00000259056	0.777	Polypeptide N-acetylgalactosaminyltransferase 5
16	9606.ENSP00000227756	0.770	Polypeptide N-acetylgalactosaminyltransferase 18
17	9606.ENSP00000376570	0.770	Polypeptide N-acetylgalactosaminyltransferase 13
18	9606.ENSP00000344260	0.755	Polypeptide N-acetylgalactosaminyltransferase 15
19	9606.ENSP00000416787	0.752	Polypeptide N-acetylgalactosaminyltransferase 11
20	9606.ENSP00000380488	0.750	Polypeptide N-acetylgalactosaminyltransferase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0001665	0.956	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity
GO:0005488	0.464	binding
GO:0005515	0.419	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0009987	0.986	cellular process
GO:0006486	0.982	protein glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0071944	0.484	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:11136	0.956	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + CMP-N-acetyl-beta-neuraminate = a beta-D-galactosyl-(1->3)-[N-acetyl-alpha-neuraminyl-(2->6)]-N-acetyl-alpha-D-galactosaminyl derivative + CMP + H(+)
EC:2.4.99.3	0.956	Transferred entry: 2.4.3.3.

[back to server]