StarFunc result for job id Q9NSD9

User Input

>input (589 residues)
MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDV
VLYKIDVPANRYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPF
AVAAVLRNIKFTKDRYDSFIELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSD
IKFKPLNKTKEYTACELMNIYKTDNHLKHYLHIIENKPLYPVIYDSNGVVLSMPPIINGD
HSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFP
ELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIEIPPTRADIIH
ACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ
EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDI
VIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEG
PAFFPGRCAEIFARGQSVGKLGVLHPDVITKFELTMPCSSLEINVGPFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3l4gB	0.994	0.994	0.000	589	0.998	0.998	3l4gB.pdb.gz	Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
2	AFDB:Q9NSD9	1.000	1.000	0.000	589	1.000	1.000	Q9NSD9.pdb.gz	SYFB_HUMAN Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3
3	AFDB:Q9VCA5	0.988	0.988	8.049E-93	589	0.621	0.621	Q9VCA5.pdb.gz	SYFB_DROME Phenylalanine--tRNA ligase beta subunit OS=Drosophila melanogaster OX=7227 GN=beta-PheRS PE=1 SV=1
4	AFDB:Q9SGE9	0.955	0.941	2.261E-81	598	0.501	0.493	Q9SGE9.pdb.gz	SYFB_ARATH Phenylalanine--tRNA ligase beta subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g72550 PE=2 SV=1
5	AFDB:O42849	0.942	0.942	4.957E-77	589	0.453	0.453	O42849.pdb.gz	SYFB_SCHPO Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=frs1 PE=3 SV=1
6	AFDB:P15624	0.946	0.936	2.720E-76	595	0.469	0.464	P15624.pdb.gz	SYFB_YEAST Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRS1 PE=1 SV=3
7	AFDB:Q386S3	0.847	0.804	3.444E-72	624	0.433	0.409	Q386S3.pdb.gz	Q386S3_TRYB2 phenylalanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.22.0005 PE=3 SV=1
8	AFDB:A5K464	0.923	0.882	8.938E-67	617	0.357	0.340	A5K464.pdb.gz	SYFB_PLAVS Phenylalanine--tRNA ligase beta subunit OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PVX_090880 PE=1 SV=1
9	PDB:7by6B	0.598	0.582	1.861E-59	606	0.357	0.347	7by6B.pdb.gz	Structural basis of malaria parasite phenylalanine tRNA-synthetase inhibition by bicyclic azetidines.
10	AFDB:Q728S0	0.663	0.509	1.499E-33	798	0.200	0.148	Q728S0.pdb.gz	SYFB_DESVH Phenylalanine--tRNA ligase beta subunit OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=pheT PE=1 SV=1
11	AFDB:P07395	0.590	0.455	1.029E-31	795	0.187	0.138	P07395.pdb.gz	SYFB_ECOLI Phenylalanine--tRNA ligase beta subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheT PE=1 SV=2
12	PDB:3pcoB	0.578	0.444	2.752E-30	795	0.188	0.140	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
13	AFDB:P9WFU1	0.656	0.485	2.119E-29	831	0.187	0.132	P9WFU1.pdb.gz	SYFB_MYCTU Phenylalanine--tRNA ligase beta subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pheT PE=1 SV=1
14	PDB:7db7B	0.588	0.434	2.108E-28	836	0.156	0.110	7db7B.pdb.gz	Re-discovery of PF-3845 as a new chemical scaffold inhibiting phenylalanyl-tRNA synthetase in Mycobacterium tuberculosis .
15	PDB:2du4A	0.309	0.387	2.267E-10	466	0.066	0.084	2du4A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
16	PDB:6zxdk	0.248	0.333	3.926E-10	430	0.088	0.121	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
17	PDB:5x6cA	0.286	0.311	8.469E-10	539	0.075	0.082	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
18	PDB:2du3A	0.306	0.337	1.827E-9	534	0.065	0.071	2du3A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.
19	PDB:7k98A	0.297	0.491	2.540E-9	343	0.076	0.131	7k98A.pdb.gz	Mycobacterium tuberculosis Phe-tRNA synthetase: structural insights into tRNA recognition and aminoacylation.
20	PDB:3l4gC	0.292	0.336	4.164E-9	508	0.080	0.093	3l4gC.pdb.gz	Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O42849	0.0	527	589	0.469	0.469	SYFB_SCHPO Phenylalanine--tRNA ligase beta subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=frs1 PE=3 SV=1
2	Q9NSD9	0.0	1211	589	1.000	1.000	SYFB_HUMAN Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3
3	Q9SGE9	0.0	600	598	0.506	0.498	SYFB_ARATH Phenylalanine--tRNA ligase beta subunit, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g72550 PE=2 SV=1
4	Q9VCA5	0.0	763	589	0.626	0.626	SYFB_DROME Phenylalanine--tRNA ligase beta subunit OS=Drosophila melanogaster OX=7227 GN=beta-PheRS PE=1 SV=1
5	P15624	1.40e-177	517	595	0.472	0.467	SYFB_YEAST Phenylalanine--tRNA ligase beta subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRS1 PE=1 SV=3
6	Q386S3	1.54e-159	472	624	0.440	0.415	Q386S3_TRYB2 phenylalanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.22.0005 PE=3 SV=1
7	A5K464	2.19e-115	358	617	0.370	0.353	SYFB_PLAVS Phenylalanine--tRNA ligase beta subunit OS=Plasmodium vivax (strain Salvador I) OX=126793 GN=PVX_090880 PE=1 SV=1
8	Q8N1G4	5.33e-23	105	583	0.098	0.099	LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1
9	Q728S0	1.51e-13	76.3	798	0.105	0.078	SYFB_DESVH Phenylalanine--tRNA ligase beta subunit OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=pheT PE=1 SV=1
10	P07395	1.46e-11	69.7	795	0.151	0.112	SYFB_ECOLI Phenylalanine--tRNA ligase beta subunit OS=Escherichia coli (strain K12) OX=83333 GN=pheT PE=1 SV=2
11	P9WFU1	0.011	41.2	831	0.031	0.022	SYFB_MYCTU Phenylalanine--tRNA ligase beta subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pheT PE=1 SV=1
12	P95141	0.78	35.0	619	0.048	0.045	FAA29_MYCTU 4-hydroxyphenylalkanoate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD29 PE=1 SV=1
13	A6NHR9	2.7	33.5	2005	0.042	0.012	SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1 PE=1 SV=2
14	Q9NGQ2	3.8	33.1	2205	0.049	0.013	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
15	Q5JPH6	4.6	32.7	523	0.041	0.046	SYEM_HUMAN Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=EARS2 PE=1 SV=2
16	Q5XVC2	6.2	32.3	715	0.046	0.038	Q5XVC2_ARATH Pseudouridine synthase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g04820 PE=1 SV=1
17	Q9CXJ1	6.7	32.0	523	0.044	0.050	SYEM_MOUSE Probable glutamate--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Ears2 PE=1 SV=1
18	A1A5D2	7.8	32.0	748	0.022	0.017	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03483 B3_4	2.5e-22	90.9	B3/4 domain
2	PF03484 B5	4.7e-13	60.5	tRNA synthetase B5 domain
3	PF19960 EAD7	44	15.3	Effector-associated domain 7
4	PF18262 PhetRS_B1	4.8e-32	121.4	Phe-tRNA synthetase beta subunit B1 domain
5	PF17759 tRNA_synthFbeta	6.7e-51	184.2	Phenylalanyl tRNA synthetase beta chain CLM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281828

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320309	0.999	phenylalanyl-tRNA synthetase alpha subunit
2	9606.ENSP00000355890	0.994	Bifunctional glutamate/proline--tRNA ligase
3	9606.ENSP00000316335	0.988	Phenylalanine--tRNA ligase, mitochondrial
4	9606.ENSP00000362576	0.956	Tyrosine--tRNA ligase, cytoplasmic
5	9606.ENSP00000364794	0.937	Isoleucine--tRNA ligase, cytoplasmic
6	9606.ENSP00000325448	0.901	Lysine--tRNA ligase
7	9606.ENSP00000261772	0.899	Alanine--tRNA ligase, cytoplasmic
8	9606.ENSP00000387710	0.880	Threonine--tRNA ligase, cytoplasmic
9	9606.ENSP00000296577	0.852	ATP-binding cassette sub-family E member 1
10	9606.ENSP00000347495	0.841	Tryptophan--tRNA ligase, cytoplasmic
11	9606.ENSP00000264161	0.829	Aspartate--tRNA ligase, cytoplasmic
12	9606.ENSP00000376946	0.829	Bardet-Biedl syndrome 10 protein
13	9606.ENSP00000338093	0.816	Probable threonine--tRNA ligase 2, cytoplasmic
14	9606.ENSP00000262027	0.798	Methionine--tRNA ligase, cytoplasmic
15	9606.ENSP00000260257	0.788	Ferredoxin-fold anticodon-binding domain-containing protein 1
16	9606.ENSP00000264914	0.745	Arylsulfatase B
17	9606.ENSP00000364815	0.745	Valine--tRNA ligase
18	9606.ENSP00000419851	0.729	GMP synthase [glutamine-hydrolyzing]
19	9606.ENSP00000381654	0.722	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
20	9606.ENSP00000354125	0.709	Eukaryotic translation initiation factor 3 subunit B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004826	1.000	phenylalanine-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:1901564	0.987	organonitrogen compound metabolic process
GO:0034641	0.986	cellular nitrogen compound metabolic process
GO:0071840	0.963	cellular component organization or biogenesis
GO:0044249	0.962	cellular biosynthetic process
GO:1901576	0.961	organic substance biosynthetic process
GO:0006412	0.926	translation
GO:0016043	0.912	cellular component organization
GO:0090304	0.909	nucleic acid metabolic process
GO:0044281	0.906	small molecule metabolic process
GO:0016070	0.900	RNA metabolic process
GO:0051262	0.888	protein tetramerization
GO:0019752	0.882	carboxylic acid metabolic process
GO:0051291	0.879	protein heterooligomerization
GO:0034660	0.740	ncRNA metabolic process
GO:0006418	0.726	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0032991	0.994	protein-containing complex
GO:0016020	0.991	membrane
GO:1902494	0.966	catalytic complex
GO:0070013	0.956	intracellular organelle lumen
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0009328	0.451	phenylalanine-tRNA ligase complex
GO:0005634	0.400	nucleus
GO:0031981	0.353	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19413	1.000	ATP + L-phenylalanine + tRNA(Phe) = AMP + diphosphate + H(+) + L-phenylalanyl-tRNA(Phe)
EC:6.1.1.20	1.000	phenylalanine--tRNA ligase.

[back to server]