StarFunc result for job id Q9NSE2

User Input

>input (258 residues)
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQYPFQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSE2	1.000	1.000	1.527E-47	258	1.000	1.000	Q9NSE2.pdb.gz	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
2	AFDB:B5XCB4	0.631	0.720	7.931E-23	225	0.391	0.449	B5XCB4.pdb.gz	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
3	AFDB:Q08BW5	0.631	0.763	3.793E-21	212	0.368	0.448	Q08BW5.pdb.gz	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
4	AFDB:V9Q4K1	0.630	0.803	1.077E-20	200	0.310	0.400	V9Q4K1.pdb.gz	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
5	AFDB:O14508	0.612	0.790	1.464E-20	198	0.345	0.449	O14508.pdb.gz	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
6	AFDB:L0N8K9	0.566	0.700	7.218E-18	207	0.244	0.304	L0N8K9.pdb.gz
7	AFDB:O14543	0.584	0.664	2.179E-17	225	0.283	0.324	O14543.pdb.gz	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
8	AFDB:Q6DEF9	0.536	0.680	3.904E-16	201	0.240	0.308	Q6DEF9.pdb.gz	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
9	AFDB:O35716	0.558	0.675	7.434E-15	212	0.256	0.311	O35716.pdb.gz	SOCS1_MOUSE Suppressor of cytokine signaling 1 OS=Mus musculus OX=10090 GN=Socs1 PE=1 SV=1
10	AFDB:Q9JLY0	0.385	0.194	1.651E-14	533	0.267	0.129	Q9JLY0.pdb.gz	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
11	PDB:8dcxB	0.295	0.321	3.278E-6	236	0.109	0.119	8dcxB.pdb.gz
12	PDB:1k9aB	0.341	0.207	1.190E-5	441	0.128	0.075	1k9aB.pdb.gz
13	PDB:4fl2A	0.276	0.134	2.486E-5	555	0.078	0.036	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:7myoB	0.256	0.232	6.243E-5	286	0.097	0.087	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
15	PDB:3qwyA	0.279	0.411	7.506E-5	170	0.089	0.135	3qwyA.pdb.gz
16	PDB:1ka6A	0.283	0.646	9.595E-5	107	0.066	0.159	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
17	PDB:4k2rA	0.272	0.134	1.154E-4	551	0.078	0.036	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
18	PDB:4gwfA	0.283	0.151	2.004E-4	497	0.105	0.054	4gwfA.pdb.gz
19	PDB:3cxlA	0.209	0.144	2.562E-4	402	0.097	0.062	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
20	PDB:5xzrA	0.273	0.142	3.080E-4	519	0.105	0.052	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NSE2	0.0	522	258	1.000	1.000	CISH_HUMAN Cytokine-inducible SH2-containing protein OS=Homo sapiens OX=9606 GN=CISH PE=1 SV=1
2	Q62225	2.28e-168	467	257	0.907	0.911	CISH_MOUSE Cytokine-inducible SH2-containing protein OS=Mus musculus OX=10090 GN=Cish PE=1 SV=1
3	O70512	2.17e-166	462	256	0.899	0.906	CISH_RAT Cytokine-inducible SH2-containing protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Cish PE=2 SV=1
4	B9EPA9	5.26e-53	173	225	0.411	0.471	B9EPA9_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
5	O14508	1.70e-50	166	198	0.341	0.444	SOCS2_HUMAN Suppressor of cytokine signaling 2 OS=Homo sapiens OX=9606 GN=SOCS2 PE=1 SV=1
6	Q08BW5	4.77e-49	162	212	0.341	0.415	Q08BW5_DANRE Cytokine-inducible SH2-containing protein OS=Danio rerio OX=7955 GN=CISH PE=2 SV=1
7	O88582	3.46e-48	160	198	0.314	0.409	SOCS2_RAT Suppressor of cytokine signaling 2 OS=Rattus norvegicus OX=10116 GN=Socs2 PE=2 SV=1
8	O35717	3.78e-48	160	198	0.314	0.409	SOCS2_MOUSE Suppressor of cytokine signaling 2 OS=Mus musculus OX=10090 GN=Socs2 PE=1 SV=1
9	B5XCB4	2.57e-47	158	225	0.391	0.449	B5XCB4_SALSA Cytokine-inducible SH2-containing protein OS=Salmo salar OX=8030 GN=CISH PE=2 SV=1
10	V9Q6E2	4.42e-47	157	200	0.337	0.435	V9Q6E2_SALSA Suppressor of cytokine signaling 2a OS=Salmo salar OX=8030 GN=SOCS2a PE=2 SV=1
11	V9Q4K1	5.47e-45	152	200	0.314	0.405	V9Q4K1_SALSA Suppressor of cytokine signaling 2-like OS=Salmo salar OX=8030 GN=SOCS2b PE=2 SV=1
12	Q7ZUC6	6.28e-24	97.4	207	0.248	0.309	Q7ZUC6_DANRE Suppressor of cytokine signaling 3 OS=Danio rerio OX=7955 GN=fj09e12 PE=2 SV=1
13	O14543	4.55e-23	95.9	225	0.279	0.320	SOCS3_HUMAN Suppressor of cytokine signaling 3 OS=Homo sapiens OX=9606 GN=SOCS3 PE=1 SV=1
14	O35718	4.01e-22	93.2	225	0.279	0.320	SOCS3_MOUSE Suppressor of cytokine signaling 3 OS=Mus musculus OX=10090 GN=Socs3 PE=1 SV=1
15	O88583	2.37e-21	91.3	225	0.271	0.311	SOCS3_RAT Suppressor of cytokine signaling 3 OS=Rattus norvegicus OX=10116 GN=Socs3 PE=1 SV=1
16	Q6DEF9	1.10e-20	89.0	201	0.244	0.313	Q6DEF9_DANRE Socs1 protein OS=Danio rerio OX=7955 GN=SOCS1 PE=2 SV=1
17	O14544	1.54e-19	89.7	535	0.209	0.101	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
18	Q9JLY0	1.71e-19	89.4	533	0.209	0.101	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
19	M9PHY7	2.59e-17	83.6	1021	0.244	0.062	M9PHY7_DROME Suppressor of cytokine signaling at 16D, isoform B OS=Drosophila melanogaster OX=7227 GN=Socs16D PE=4 SV=1
20	A0A087X1Q5	2.43e-16	80.5	553	0.209	0.098	A0A087X1Q5_HUMAN Suppressor of cytokine signaling 7 (Fragment) OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00017 SH2	2.7e-08	45.1	SH2 domain
2	PF07525 SOCS_box	7.4e-08	43.9	SOCS box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000015482

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000004398	0.973	Core component of multiple SCF-like ECS (Elongin BC-Cullin 2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition component. ECS(SOCS1) seems to direct ubiquitination of JAK2. Seems to be involved in proteosomal degradation of p53/TP53 stimulated by ade [...]
2	9601.ENSPPYP00000009439	0.958	Signal transducer and activator of transcription 5A
3	9601.ENSPPYP00000009440	0.958	Signal transducer and activator of transcription 5B
4	9601.ENSPPYP00000014555	0.941	Pongo abelii signal transducer and activator of transcription 1, 91kDa (STAT1), mRNA
5	9601.ENSPPYP00000009437	0.940	Signal transducer and activator of transcription 3
6	9601.ENSPPYP00000005333	0.935	Pongo abelii signal transducer and activator of transcription 6, interleukin-4 induced (STAT6), mRNA
7	9601.ENSPPYP00000024078	0.929	Erythropoietin receptor
8	9601.ENSPPYP00000007934	0.918	Elongin B
9	9601.ENSPPYP00000021551	0.907	Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO)
10	9601.ENSPPYP00000020952	0.903	Belongs to the SKP1 family.
11	9601.ENSPPYP00000023677	0.903	Uncharacterized protein
12	9601.ENSPPYP00000004644	0.877	Uncharacterized protein
13	9601.ENSPPYP00000001481	0.871	Janus kinase 1
14	9601.ENSPPYP00000017194	0.871	Uncharacterized protein
15	9601.ENSPPYP00000010896	0.830	Janus kinase 3
16	9601.ENSPPYP00000022294	0.818	Cullin-2
17	9601.ENSPPYP00000015846	0.786	Ring finger protein 7
18	9601.ENSPPYP00000017241	0.782	Growth hormone receptor
19	9601.ENSPPYP00000011782	0.746	Tyrosine kinase 2
20	9601.ENSPPYP00000016803	0.730	Interleukin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.331	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.998	signal transduction
GO:0042221	0.484	response to chemical
GO:0048518	0.477	positive regulation of biological process
GO:0007166	0.461	cell surface receptor signaling pathway
GO:0010033	0.448	response to organic substance
GO:0070887	0.443	cellular response to chemical stimulus
GO:0071310	0.434	cellular response to organic substance
GO:0048523	0.382	negative regulation of cellular process
GO:0048522	0.364	positive regulation of cellular process
GO:0019222	0.356	regulation of metabolic process
GO:0048583	0.336	regulation of response to stimulus
GO:0031323	0.327	regulation of cellular metabolic process
GO:0060255	0.323	regulation of macromolecule metabolic process
GO:0071345	0.314	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.997	membrane
GO:0071944	0.995	cell periphery
GO:0005886	0.994	plasma membrane
GO:0005829	0.991	cytosol
GO:0043226	0.698	organelle
GO:0043231	0.681	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]