StarFunc result for job id Q9NSE4

User Input

>input (1012 residues)
MRWGLRPRGPGAAALATARSLWGTPRLPCSPGWQGATKRLLVRSVSGASNHQPNSNSGRY
RDTVLLPQTSFPMKLLGRQQPDTELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANG
DPHVGHALNKILKDIANRFHMMNGSKIHFVPGWDCHGLPIEIKVLSELGREAQNLSAMEI
RKKARSFAKAAIEKQKSAFIRWGIMADWNNCYYTFDGKYEAKQLRTFYQMYDKGLVYRSY
KPVFWSPSSRTALAEAELEYNPEHVSRSIYVKFPLLKPSPKLASLIDGSSPVSILVWTTQ
PWTIPANEAVCYMPESKYAVVKCSKSGDLYVLAADKVASVASTLETTFETISTLSGVDLE
NGTCSHPLIPDKASPLLPANHVTMAKGTGLVHTAPAHGMEDYGVASQHNLPMDCLVDEDG
VFTDVAGPELQNKAVLEEGTDVVIKMLQTAKNLLKEEKLVHSYPYDWRTKKPVVIRASKQ
WFINITDIKTAAKELLKKVKFIPGSALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTK
DEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQDILDIW
FDSGTSWSYVLPGPDQRADLYLEGKDQLGGWFQSSLLTSVAARKRAPYKTVIVHGFTLGE
KGEKMSKSLGNVIHPDVVVNGGQDQSKEPPYGADVLRWWVADSNVFTEVAIGPSVLNAAR
DDISKLRNTLRFLLGNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANKITELYKQYDFG
KVVRLLRTFYTRELSNFYFSIIKDRLYCEKENDPKRRSCQTALVEILDVIVRSFAPILPH
LAEEVFQHIPYIKEPKSVFRTGWISTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAE
YKVITVIEPGLLFEIIEMLQSEETSSTSQLNELMMASESTLLAQEPREMTADVIELKGKF
LINLEGGDIREESSYKVIVMPTTKEKCPRCWKYTAESSDTLCPRCAEVVSGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BIJ6	0.976	0.976	0.000	1012	0.833	0.833	Q8BIJ6.pdb.gz	SYIM_MOUSE Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Iars2 PE=1 SV=1
2	AFDB:Q9NSE4	1.000	1.000	0.000	1012	1.000	1.000	Q9NSE4.pdb.gz	SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2
3	AFDB:Q8RXK8	0.889	0.826	1.625E-86	1093	0.406	0.376	Q8RXK8.pdb.gz	SYIM_ARATH Isoleucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA2 PE=2 SV=1
4	AFDB:Q9VUY4	0.857	0.920	9.703E-83	941	0.370	0.397	Q9VUY4.pdb.gz	Q9VUY4_DROME isoleucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=IleRS-m PE=1 SV=2
5	AFDB:P48526	0.829	0.837	5.717E-80	1002	0.348	0.351	P48526.pdb.gz	SYIM_YEAST Isoleucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISM1 PE=1 SV=2
6	AFDB:Q9USL3	0.850	0.883	2.056E-78	973	0.346	0.360	Q9USL3.pdb.gz	SYIM_SCHPO Isoleucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ism1 PE=3 SV=1
7	AFDB:P00956	0.828	0.891	1.443E-75	938	0.343	0.370	P00956.pdb.gz	SYI_ECOLI Isoleucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=ileS PE=1 SV=5
8	AFDB:Q72AR5	0.839	0.903	2.128E-72	938	0.338	0.365	Q72AR5.pdb.gz	SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=ileS PE=1 SV=1
9	AFDB:Q38A55	0.735	0.656	7.125E-53	1143	0.239	0.212	Q38A55.pdb.gz	Q38A55_TRYB2 isoleucine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1220 PE=3 SV=1
10	AFDB:Q6PGU7	0.711	0.577	5.627E-51	1271	0.236	0.188	Q6PGU7.pdb.gz
11	PDB:7d5cA	0.707	0.771	3.643E-49	919	0.223	0.246	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
12	PDB:6lpfB	0.451	0.454	5.090E-30	1006	0.158	0.159	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
13	PDB:3zgzD	0.409	0.471	2.015E-24	867	0.150	0.175	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
14	PDB:4ariA	0.396	0.478	3.404E-24	821	0.153	0.189	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
15	PDB:6ax8A	0.400	0.752	8.147E-14	509	0.099	0.196	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
16	PDB:1u0bB	0.164	0.331	1.091E-4	461	0.041	0.089	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:1li7B	0.152	0.369	2.223E-3	375	0.024	0.064	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
18	PDB:5yymA	0.284	0.460	8.614E-3	581	0.071	0.124	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
19	PDB:4r3zB	0.158	0.229	3.975E-2	659	0.037	0.056	4r3zB.pdb.gz
20	PDB:5b63C	0.125	0.206	3.975E-2	553	0.041	0.074	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00956	0.0	585	938	0.354	0.382	SYI_ECOLI Isoleucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=ileS PE=1 SV=5
2	P48526	0.0	603	1002	0.365	0.368	SYIM_YEAST Isoleucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISM1 PE=1 SV=2
3	Q72AR5	0.0	573	938	0.347	0.374	SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=ileS PE=1 SV=1
4	Q8BIJ6	0.0	1799	1012	0.834	0.834	SYIM_MOUSE Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Iars2 PE=1 SV=1
5	Q8RXK8	0.0	700	1093	0.400	0.371	SYIM_ARATH Isoleucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA2 PE=2 SV=1
6	Q9NSE4	0.0	2103	1012	1.000	1.000	SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2
7	Q9USL3	0.0	593	973	0.359	0.373	SYIM_SCHPO Isoleucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ism1 PE=3 SV=1
8	Q9VUY4	0.0	686	941	0.378	0.407	Q9VUY4_DROME isoleucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=IleRS-m PE=1 SV=2
9	P9WFV3	1.48e-81	288	1041	0.240	0.233	SYI_MYCTU Isoleucine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ileS PE=1 SV=1
10	P41252	1.79e-80	288	1262	0.240	0.193	SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2
11	A0A0A0MSX9	2.01e-80	288	1242	0.240	0.196	A0A0A0MSX9_HUMAN isoleucine--tRNA ligase OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=1
12	Q38A55	3.18e-79	283	1143	0.228	0.202	Q38A55_TRYB2 isoleucine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1220 PE=3 SV=1
13	Q8BU30	9.71e-78	280	1262	0.220	0.177	SYIC_MOUSE Isoleucine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Iars1 PE=1 SV=2
14	Q8MSW0	3.87e-77	278	1229	0.231	0.190	Q8MSW0_DROME isoleucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=IleRS PE=1 SV=1
15	F4JLM5	9.68e-76	273	1190	0.214	0.182	SYIC_ARATH Isoleucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g10320 PE=2 SV=1
16	P09436	1.33e-75	272	1072	0.242	0.229	SYIC_YEAST Isoleucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILS1 PE=1 SV=1
17	O13651	9.71e-75	269	1064	0.213	0.203	SYIC_SCHPO Isoleucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=irs1 PE=3 SV=1
18	F4KE63	7.00e-53	203	974	0.207	0.215	SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EMB2247 PE=3 SV=1
19	Q72E47	4.17e-50	194	884	0.184	0.210	SYV_DESVH Valine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=valS PE=1 SV=1
20	Q9U1Q4	2.93e-49	192	1050	0.187	0.180	SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=glp-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	1.7e-23	94.8	Anticodon-binding domain of tRNA ligase
2	PF18912 DZR_2	83	14.5	Double zinc ribbon domain
3	PF00133 tRNA-synt_1	3e-162	552.7	tRNA synthetases class I (I, L, M and V)
4	PF01406 tRNA-synt_1e	10	16.9	tRNA synthetases class I (C) catalytic domain
5	PF09334 tRNA-synt_1g	5.2e-18	76.6	tRNA synthetases class I (M)
6	PF13603 tRNA-synt_1_2	0.0011	30.0	Leucyl-tRNA synthetase, Domain 2
7	PF06827 zf-FPG_IleRS	0.086	24.0	Zinc finger found in FPG and IleRS

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355890	0.978	Bifunctional glutamate/proline--tRNA ligase
2	9606.ENSP00000307567	0.975	Glutamine--tRNA ligase
3	9606.ENSP00000377954	0.973	Leucine--tRNA ligase, cytoplasmic
4	9606.ENSP00000360327	0.961	Probable proline--tRNA ligase, mitochondrial
5	9606.ENSP00000261772	0.951	Alanine--tRNA ligase, cytoplasmic
6	9606.ENSP00000281038	0.945	Probable asparagine--tRNA ligase, mitochondrial
7	9606.ENSP00000369897	0.934	Cysteine--tRNA ligase, cytoplasmic
8	9606.ENSP00000362576	0.930	Tyrosine--tRNA ligase, cytoplasmic
9	9606.ENSP00000395196	0.929	Probable glutamate--tRNA ligase, mitochondrial
10	9606.ENSP00000257347	0.925	Probable cysteine--tRNA ligase, mitochondrial
11	9606.ENSP00000387710	0.921	Threonine--tRNA ligase, cytoplasmic
12	9606.ENSP00000244571	0.920	Alanine--tRNA ligase, mitochondrial
13	9606.ENSP00000358549	0.916	Probable arginine--tRNA ligase, mitochondrial
14	9606.ENSP00000262027	0.911	Methionine--tRNA ligase, cytoplasmic
15	9606.ENSP00000358060	0.907	Threonine--tRNA ligase, mitochondrial
16	9606.ENSP00000256854	0.904	Asparagine--tRNA ligase, cytoplasmic
17	9606.ENSP00000235521	0.898	Tryptophan--tRNA ligase, mitochondrial
18	9606.ENSP00000320658	0.898	Tyrosine--tRNA ligase, mitochondrial
19	9606.ENSP00000282276	0.891	Methionine--tRNA ligase, mitochondrial
20	9606.ENSP00000316335	0.886	Phenylalanine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004812	1.000	aminoacyl-tRNA ligase activity
GO:0004822	0.985	isoleucine-tRNA ligase activity
GO:0005488	0.935	binding
GO:0005515	0.804	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0090304	0.995	nucleic acid metabolic process
GO:0006418	0.988	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.817	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	1.000	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:11060	0.985	ATP + L-isoleucine + tRNA(Ile) = AMP + diphosphate + L-isoleucyl-tRNA(Ile)
EC:6.1.1.5	0.985	isoleucine--tRNA ligase.

[back to server]