StarFunc result for job id Q9NSI6

User Input

>input (2320 residues)
MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHN
RSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKDCRH
TVWKGSAFAALHRGRPPEMPVNYGSPPNLVEIHRGKQLTGCSTFSTAFPGTMYQHIKMHR
RILGHLSAVYCVAFDRTGHRIFTGSDDCLVKIWSTHNGRLLSTLRGHSAEISDMAVNYEN
TMIAAGSCDKIIRVWCLRTCAPVAVLQGHTGSITSLQFSPMAKGSQRYMVSTGADGTVCF
WQWDLESLKFSPRPLKFTEKPRPGVQMLCSSFSVGGMFLATGSTDHVIRMYFLGFEAPEK
IAELESHTDKVDSIQFCNNGDRFLSGSRDGTARIWRFEQLEWRSILLDMATRISGDLSSE
EERFMKPKVTMIAWNQNDSIVVTAVNDHVLKVWNSYTGQLLHNLMGHADEVFVLETHPFD
SRIMLSAGHDGSIFIWDITKGTKMKHYFNMIEGQGHGAVFDCKFSQDGQHFACTDSHGHL
LIFGFGCSKPYEKIPDQMFFHTDYRPLIRDSNNYVLDEQTQQAPHLMPPPFLVDVDGNPH
PTKYQRLVPGRENSADEHLIPQLGYVATSDGEVIEQIISLQTNDNDERSPESSILDGMIR
QLQQQQDQRMGADQDTIPRGLSNGEETPRRGFRRLSLDIQSPPNIGLRRSGQVEGVRQMH
QNAPRSQIATERDLQAWKRRVVVPEVPLGIFRKLEDFRLEKGEEERNLYIIGRKRKTLQL
SHKSDSVVLVSQSRQRTCRRKYPNYGRRNRSWRELSSGNESSSSVRHETSCDQSEGSGSS
EEDEWRSDRKSESYSESSSDSSSRYSDWTADAGINLQPPLRTSCRRRITRFCSSSEDEIS
TENLSPPKRRRKRKKENKPKKENLRRMTPAELANMEHLYEFHPPVWITDTTLRKSPFVPQ
MGDEVIYFRQGHEAYIEAVRRNNIYELNPNKEPWRKMDLRDQELVKIVGIRYEVGPPTLC
CLKLAFIDPATGKLMDKSFSIRYHDMPDVIDFLVLRQFYDEARQRNWQSCDRFRSIIDDA
WWFGTVLSQEPYQPQYPDSHFQCYIVRWDNTEIEKLSPWDMEPIPDNVDPPEELGASISV
TTDELEKLLYKPQAGEWGQKSRDEECDRIISGIDQLLNLDIAAAFAGPVDLCTYPKYCTV
VAYPTDLYTIRMRLVNRFYRRLSALVWEVRYIEHNARTFNEPESVIARSAKKITDQLLKF
IKNQHCTNISELSNTSENDEQNAEDLDDSDLPKTSSGRRRVHDGKKSIRATNYVESNWKK
QCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCK
DIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQRFKQ
RQNCKGDSQPNKSIRNLKPKRLKSQTKIIPELVGSPTQSTSSRTAYLGTHKTSAGISSGV
TSGDSSDSAESSERRKRNRPITNGSTLSESEVEDSLATSLSSSASSSSEESKESSRARES
SSRSGLSRSSNLRVTRTRAAQRKTGPVSLANGCGRKATRKRVYLSDSDNNSLETGEILKA
RAGNNRKVLRKCAAVAANKIKLMSDVEENSSSESVCSGRKLPHRNASAVARKKLLHNSED
EQSLKSEIEEEELKDENQLLPVSSSHTAQSNVDESENRDSESESDLRVARKNWHANGYKS
HTPAPSKTKFLKIESSEEDSKSHDSDHACNRTAGPSTSVQKLKAESISEEADSEPGRSGG
RKYNTFHKNASFFKKTKILSDSEDSESEEQDREDGKCHKMEMNPISGNLNCDPIAMSQCS
SDHGCETDLDSDDDKIEKPNNFMKDSASQDNGLSRKISRKRVCSSDSDSSLQVVKKSSKA
RTGLLRITRRCAATAANKIKLMSDVEDVSLENVHTRSKNGRKKPLHLACTTAKKKLSDCE
GSVHCEVPSEQYACEGKPPDPDSEGSTKVLSQALNGDSDSEDMLNSEHKHRHTNIHKIDA
PSKRKSSSVTSSGEDSKSHIPGSETDRTFSSESTLAQKATAENNFEVELNYGLRRWNGRR
LRTYGKAPFSKTKVIHDSQETAEKEVKRKRSHPELENVKISETTGNSKFRPDTSSKSSDL
GSVTESDIDCTDNTKTKRRKTKGKAKVVRKEFVPRDREPNTKVRTCMHNQKDAVQMPSET
LKAKMVPEKVPRRCATVAANKIKIMSNLKETISGPENVWIRKSSRKLPHRNASAAAKKKL
LNVYKEDDTTINSESEKELEDINRKMLFLRGFRSWKENAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6RI45	0.249	0.316	0.000	1802	0.425	0.548	Q6RI45.pdb.gz	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
2	AFDB:Q921C3	0.259	0.261	0.000	2304	0.797	0.803	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
3	AFDB:Q9NSI6	1.000	1.000	0.000	2320	1.000	1.000	Q9NSI6.pdb.gz	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
4	AFDB:Q9VC96	0.224	0.232	0.000	2232	0.319	0.332	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
5	PDB:5mzhB	0.131	0.681	5.339E-16	415	0.038	0.214	5mzhB.pdb.gz
6	PDB:5nnzA	0.128	0.817	9.793E-16	335	0.033	0.227	5nnzA.pdb.gz
7	PDB:5jcsq	0.132	0.590	4.937E-15	488	0.035	0.166	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
8	PDB:7bt6x	0.134	0.598	4.937E-15	488	0.036	0.172	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
9	PDB:6ttuT	0.106	0.545	3.546E-14	394	0.031	0.183	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
10	PDB:2h9lA	0.107	0.628	4.126E-14	321	0.029	0.212	2h9lA.pdb.gz
11	PDB:4v7fq	0.126	0.608	2.080E-13	443	0.034	0.176	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
12	PDB:7ajtUA	0.084	0.214	5.168E-13	834	0.031	0.088	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:1vyhC	0.103	0.616	6.654E-13	310	0.028	0.206	1vyhC.pdb.gz
14	PDB:5juyB	0.075	0.129	8.567E-13	1234	0.045	0.085	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
15	AFDB:M9PB01	0.114	0.111	4.244E-9	2397	0.110	0.107	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
16	AFDB:P35658	0.103	0.114	5.438E-7	2090	0.117	0.130	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
17	AFDB:Q9LM88	0.046	0.141	6.810E-6	652	0.042	0.149	Q9LM88.pdb.gz	Q9LM88_ARATH At1g20670 OS=Arabidopsis thaliana OX=3702 GN=At1g20670 PE=1 SV=1
18	AFDB:Q9W1X4	0.117	0.152	8.769E-6	1711	0.107	0.146	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
19	AFDB:Q8CDM1	0.055	0.115	2.535E-5	1040	0.026	0.058	Q8CDM1.pdb.gz	ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Atad2 PE=1 SV=1
20	AFDB:Q9ULI0	0.054	0.082	2.950E-5	1458	0.034	0.055	Q9ULI0.pdb.gz	ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6RI45	0.0	1887	1802	0.400	0.515	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
2	Q8VDD9	0.0	1830	1821	0.399	0.508	PHIP_MOUSE PH-interacting protein OS=Mus musculus OX=10090 GN=Phip PE=1 SV=2
3	Q8WWQ0	0.0	1121	1821	0.238	0.303	PHIP_HUMAN PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2
4	Q921C3	0.0	3522	2304	0.795	0.800	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
5	Q9NSI6	0.0	4833	2320	1.000	1.000	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
6	Q9VC96	0.0	681	2232	0.134	0.140	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
7	Q8SX63	1.20e-146	505	1765	0.111	0.146	Q8SX63_DROME LD40380p OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=2 SV=1
8	Q9VZF4	4.18e-28	127	1326	0.042	0.073	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
9	Q57W14	6.99e-26	115	419	0.037	0.208	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
10	Q1LV15	8.02e-25	112	415	0.037	0.210	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
11	Q8N136	9.91e-25	111	415	0.038	0.212	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
12	Q8VBV4	2.39e-23	110	710	0.036	0.118	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
13	Q969H0	7.34e-23	108	707	0.037	0.123	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
14	Q9D4T2	7.52e-23	103	304	0.035	0.270	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
15	Q3Y8L7	8.39e-22	103	446	0.040	0.209	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
16	B7ZDC8	8.68e-22	104	544	0.037	0.158	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
17	Q9FN19	1.67e-21	103	613	0.044	0.165	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
18	Q7ZUV2	5.23e-21	102	694	0.028	0.095	KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio OX=7955 GN=katnb1 PE=2 SV=1
19	Q57X86	7.21e-21	102	698	0.033	0.109	Q57X86_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.470 PE=4 SV=1
20	D3Z7A5	1.22e-20	99.4	415	0.035	0.195	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00018	33.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00439 Bromodomain	9e-34	126.8	Bromodomain
3	PF11545 HemeBinding_Shp	3.2e+02	12.6	Cell surface heme-binding protein Shp
4	PF20426 NBCH_WD40	0.00053	30.5	Neurobeachin beta propeller domain
5	PF00400 WD40	4.2e-32	120.8	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395654	0.967	Transcription activator BRG1
2	9606.ENSP00000293328	0.912	Signal transducer and activator of transcription 5B
3	9606.ENSP00000341208	0.912	Signal transducer and activator of transcription 5A
4	9606.ENSP00000478672	0.908	V(D)J recombination-activating protein 2
5	9606.ENSP00000299440	0.906	V(D)J recombination-activating protein 1
6	9606.ENSP00000275034	0.824	PH-interacting protein
7	9606.ENSP00000351008	0.820	Lebercilin-like protein
8	9606.ENSP00000329915	0.817	Proteasome assembly chaperone 1
9	9606.ENSP00000381699	0.777	Beta-1,3-galactosyltransferase 5
10	9606.ENSP00000362441	0.767	Transcriptional regulator ATRX
11	9606.ENSP00000307208	0.741	Nucleosome-remodeling factor subunit BPTF
12	9606.ENSP00000284486	0.684	Protein FAM167A
13	9606.ENSP00000381577	0.684	Ubiquitin carboxyl-terminal hydrolase 34
14	9606.ENSP00000393596	0.680	Baculoviral IAP repeat-containing protein 6
15	9606.ENSP00000370503	0.673	Cerebral cavernous malformations 2 protein
16	9606.ENSP00000376686	0.671	Lebercilin
17	9606.ENSP00000296328	0.663	UBX domain-containing protein 7
18	9606.ENSP00000351575	0.653	Transcription factor TFIIIB component B'' homolog
19	9606.ENSP00000396995	0.652	Non-canonical poly(A) RNA polymerase PAPD5
20	9606.ENSP00000356579	0.647	Centrosome-associated protein 350

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050794	0.898	regulation of cellular process
GO:0071840	0.882	cellular component organization or biogenesis
GO:0022604	0.876	regulation of cell morphogenesis
GO:0016043	0.873	cellular component organization
GO:0019222	0.731	regulation of metabolic process
GO:0006996	0.654	organelle organization
GO:0060255	0.638	regulation of macromolecule metabolic process
GO:0080090	0.626	regulation of primary metabolic process
GO:0051171	0.625	regulation of nitrogen compound metabolic process
GO:0008360	0.550	regulation of cell shape
GO:0007010	0.512	cytoskeleton organization
GO:0031323	0.458	regulation of cellular metabolic process
GO:0010468	0.434	regulation of gene expression
GO:0019219	0.431	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.425	regulation of macromolecule biosynthetic process
GO:0031326	0.422	regulation of cellular biosynthetic process
GO:0051252	0.419	regulation of RNA metabolic process
GO:0006355	0.406	regulation of DNA-templated transcription
GO:0048518	0.342	positive regulation of biological process
GO:0048522	0.334	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.959	cytosol
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0005730	0.650	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]