StarFunc result for job id Q9NSI8

User Input

>input (373 residues)
MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTS
NNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSL
KASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYD
TDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNS
KKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAE
NFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLS
DMVHKIIITEPSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSI8	0.999	0.999	2.031E-55	373	1.000	1.000	Q9NSI8.pdb.gz	SAMN1_HUMAN SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1
2	AFDB:P57725	0.261	0.262	3.427E-46	372	0.836	0.839	P57725.pdb.gz	SAMN1_MOUSE SAM domain-containing protein SAMSN-1 OS=Mus musculus OX=10090 GN=Samsn1 PE=1 SV=2
3	AFDB:O94885	0.254	0.096	4.222E-22	1247	0.416	0.124	O94885.pdb.gz	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3
4	AFDB:P59808	0.264	0.103	6.442E-22	1230	0.418	0.127	P59808.pdb.gz	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
5	AFDB:Q0KI30	0.178	0.069	6.487E-16	1064	0.279	0.098	Q0KI30.pdb.gz	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2
6	AFDB:A0A0B4K6C1	0.193	0.071	6.829E-15	1034	0.249	0.090	A0A0B4K6C1.pdb.gz	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
7	AFDB:Q8SZS0	0.178	0.083	8.694E-15	952	0.265	0.104	Q8SZS0.pdb.gz	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
8	AFDB:Q5AQ36	0.170	0.163	3.416E-5	388	0.107	0.103	Q5AQ36.pdb.gz	SHO1_CANAL High osmolarity signaling protein SHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SHO1 PE=2 SV=2
9	AFDB:P59672	0.155	0.053	1.013E-4	1150	0.225	0.073	P59672.pdb.gz	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
10	AFDB:Q9VU84	0.166	0.118	1.454E-4	531	0.091	0.064	Q9VU84.pdb.gz	DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster OX=7227 GN=Abp1 PE=1 SV=1
11	PDB:3qwyA	0.156	0.334	5.837E-4	170	0.040	0.088	3qwyA.pdb.gz
12	PDB:3ehqA	0.138	0.275	6.996E-4	182	0.043	0.088	3ehqA.pdb.gz
13	PDB:2lqnA	0.159	0.193	8.385E-4	303	0.056	0.069	2lqnA.pdb.gz
14	PDB:2dybA	0.144	0.179	1.204E-3	298	0.038	0.047	2dybA.pdb.gz
15	PDB:2eyzA	0.156	0.190	1.952E-3	304	0.051	0.062	2eyzA.pdb.gz
16	PDB:1griA	0.146	0.254	2.074E-3	211	0.038	0.066	1griA.pdb.gz
17	PDB:1k9aB	0.144	0.122	4.028E-3	441	0.032	0.027	1k9aB.pdb.gz
18	PDB:1k0xA	0.144	0.462	6.528E-3	108	0.035	0.120	1k0xA.pdb.gz
19	PDB:4mt6A	0.132	0.126	1.935E-2	389	0.032	0.031	4mt6A.pdb.gz
20	PDB:6x5hA	0.140	0.112	1.935E-2	467	0.027	0.021	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57725	0.0	527	372	0.836	0.839	SAMN1_MOUSE SAM domain-containing protein SAMSN-1 OS=Mus musculus OX=10090 GN=Samsn1 PE=1 SV=2
2	Q9NSI8	0.0	763	373	1.000	1.000	SAMN1_HUMAN SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1
3	Q8K352	1.43e-73	235	380	0.440	0.432	SASH3_MOUSE SAM and SH3 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Sash3 PE=1 SV=2
4	P59808	2.66e-63	221	1230	0.397	0.120	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
5	O94885	9.23e-63	219	1247	0.408	0.122	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3
6	Q0KI30	9.50e-25	108	1064	0.209	0.073	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2
7	A0A0B4KHM3	9.65e-25	108	1027	0.209	0.076	A0A0B4KHM3_DROME Shal K[+] channel interacting protein, isoform J OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
8	Q8SZS0	1.12e-24	108	952	0.209	0.082	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
9	A0A0B4KHV7	1.25e-24	108	1080	0.209	0.072	A0A0B4KHV7_DROME Shal K[+] channel interacting protein, isoform I OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
10	Q8T9B0	6.81e-24	105	778	0.206	0.099	Q8T9B0_DROME SD09611p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
11	A0A0B4K6C1	2.01e-23	104	1034	0.206	0.074	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
12	Q95RX2	1.25e-07	54.3	237	0.099	0.156	Q95RX2_DROME LD04190p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
13	Q7K115	1.56e-05	49.3	598	0.062	0.038	Q7K115_DROME LD16982p OS=Drosophila melanogaster OX=7227 GN=Nost PE=2 SV=1
14	H1UUM2	1.64e-05	49.3	768	0.062	0.030	H1UUM2_DROME FI17805p1 OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
15	D5SHR1	1.74e-05	49.3	671	0.062	0.034	D5SHR1_DROME IP05844p OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
16	X2JAX8	1.74e-05	49.3	1330	0.062	0.017	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
17	M9MQH0	1.81e-05	48.9	675	0.062	0.034	M9MQH0_DROME Nostrin, isoform D OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
18	B5RJS0	1.87e-05	49.3	1225	0.062	0.019	B5RJS0_DROME IP20241p OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
19	P59672	1.04e-04	47.0	1150	0.067	0.022	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
20	Q9XYM0	1.96e-04	45.1	271	0.059	0.081	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	6.1e-06	37.9	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	2.2e-08	45.4	SAM domain (Sterile alpha motif)
3	PF00018 SH3_1	29	15.7	SH3 domain
4	PF07653 SH3_2	0.14	23.3	Variant SH3 domain
5	PF12485 SLY	1.6e-50	183.3	Lymphocyte signaling adaptor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000012609

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000014317	0.714	Kynureninase
2	9601.ENSPPYP00000004561	0.702	Cytotoxic and regulatory T cell molecule
3	9601.ENSPPYP00000006502	0.693	Sec1 family domain containing 1
4	9601.ENSPPYP00000019199	0.676	Uncharacterized protein
5	9601.ENSPPYP00000015506	0.583	Macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
6	9601.ENSPPYP00000020106	0.583	Hepatocyte growth factor receptor
7	9601.ENSPPYP00000016988	0.558	Sin3A-associated protein, 30kDa
8	9601.ENSPPYP00000015587	0.557	Lactotransferrin
9	9601.ENSPPYP00000015720	0.554	RNA binding motif, single stranded interacting protein 3
10	9601.ENSPPYP00000001145	0.527	CD58 molecule
11	9601.ENSPPYP00000016831	0.524	Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
12	9601.ENSPPYP00000012109	0.514	Transglutaminase 3
13	9601.ENSPPYP00000008258	0.509	Protease, serine, 36

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0045309	0.996	protein phosphorylated amino acid binding
GO:0001784	0.991	phosphotyrosine residue binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0051239	0.973	regulation of multicellular organismal process
GO:0048583	0.928	regulation of response to stimulus
GO:0009892	0.898	negative regulation of metabolic process
GO:0031400	0.886	negative regulation of protein modification process
GO:0051241	0.873	negative regulation of multicellular organismal process
GO:0002682	0.870	regulation of immune system process
GO:0002694	0.856	regulation of leukocyte activation
GO:0048523	0.845	negative regulation of cellular process
GO:0050776	0.836	regulation of immune response
GO:0002683	0.834	negative regulation of immune system process
GO:0010563	0.760	negative regulation of phosphorus metabolic process
GO:0051249	0.757	regulation of lymphocyte activation
GO:0045936	0.748	negative regulation of phosphate metabolic process
GO:0050730	0.708	regulation of peptidyl-tyrosine phosphorylation
GO:0050864	0.704	regulation of B cell activation
GO:0001933	0.696	negative regulation of protein phosphorylation
GO:0002819	0.673	regulation of adaptive immune response
GO:0048585	0.633	negative regulation of response to stimulus
GO:0050732	0.597	negative regulation of peptidyl-tyrosine phosphorylation
GO:0050777	0.520	negative regulation of immune response
GO:0050866	0.510	negative regulation of cell activation
GO:0009987	0.499	cellular process
GO:0048518	0.426	positive regulation of biological process
GO:0048522	0.356	positive regulation of cellular process
GO:0002695	0.328	negative regulation of leukocyte activation
GO:0051250	0.321	negative regulation of lymphocyte activation
GO:0050896	0.305	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.948	cytoplasm
GO:0005829	0.921	cytosol
GO:0016020	0.362	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]