StarFunc result for job id Q9NST1

User Input

>input (481 residues)
MYDAERGWSLSFAGCGFLGFYHVGATRCLSEHAPHLLRDARMLFGASAGALHCVGVLSGI
PLEQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTR
VSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKT
TITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLR
GYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDE
LLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTL
PVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCT
PEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NST1	1.000	1.000	2.675E-78	481	1.000	1.000	Q9NST1.pdb.gz	PLPL3_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 OS=Homo sapiens OX=9606 GN=PNPLA3 PE=1 SV=2
2	AFDB:D3Z9J9	0.752	0.849	6.206E-50	425	0.578	0.654	D3Z9J9.pdb.gz	D3Z9J9_RAT Patatin-like phospholipase domain containing 3 OS=Rattus norvegicus OX=10116 GN=Pnpla3 PE=1 SV=2
3	AFDB:A0A0R4IUV2	0.717	0.729	1.698E-41	473	0.403	0.410	A0A0R4IUV2.pdb.gz
4	AFDB:Q96AD5	0.709	0.678	1.160E-38	504	0.397	0.379	Q96AD5.pdb.gz	PLPL2_HUMAN Patatin-like phospholipase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PNPLA2 PE=1 SV=1
5	AFDB:Q8BJ56	0.704	0.697	7.166E-38	486	0.391	0.387	Q8BJ56.pdb.gz	PLPL2_MOUSE Patatin-like phospholipase domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pnpla2 PE=1 SV=1
6	AFDB:Q7Z6Z6	0.673	0.753	1.099E-34	429	0.324	0.364	Q7Z6Z6.pdb.gz	PLPL5_HUMAN Patatin-like phospholipase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PNPLA5 PE=1 SV=1
7	AFDB:Q8T3F2	0.574	0.374	4.405E-29	751	0.308	0.197	Q8T3F2.pdb.gz	Q8T3F2_CAEEL PNPLA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atgl-1 PE=1 SV=1
8	AFDB:E1JI03	0.554	0.484	1.410E-28	553	0.289	0.251	E1JI03.pdb.gz	E1JI03_DROME Brummer, isoform B OS=Drosophila melanogaster OX=7227 GN=bmm PE=4 SV=1
9	AFDB:Q8N8W4	0.505	0.458	3.412E-25	532	0.272	0.246	Q8N8W4.pdb.gz	PLPL1_HUMAN Omega-hydroxyceramide transacylase OS=Homo sapiens OX=9606 GN=PNPLA1 PE=1 SV=3
10	AFDB:Q3V1D5	0.497	0.401	1.811E-24	599	0.268	0.215	Q3V1D5.pdb.gz	PLPL1_MOUSE Omega-hydroxyceramide transacylase OS=Mus musculus OX=10090 GN=Pnpla1 PE=1 SV=1
11	PDB:4akfA	0.278	0.244	5.104E-6	560	0.141	0.121	4akfA.pdb.gz
12	PDB:6aunA	0.277	0.219	9.840E-4	618	0.071	0.055	6aunA.pdb.gz
13	PDB:5ixcA	0.190	0.141	1.034E-1	684	0.069	0.048	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5izrC	0.188	0.143	4.716E-1	659	0.048	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5A	0.173	0.117	6.388E-1	757	0.044	0.028	5iz5A.pdb.gz
16	PDB:5iz5B	0.168	0.113	9.103E-1	746	0.054	0.035	5iz5B.pdb.gz
17	PDB:3gyxA	0.069	0.053	1.007	662	0.040	0.029	3gyxA.pdb.gz	Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit
18	PDB:1cjyA	0.162	0.127	1.114	633	0.042	0.032	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
19	PDB:6lthO	0.078	0.107	1.364	325	0.069	0.102	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
20	PDB:5svaU	0.063	0.145	2.263	156	0.050	0.154	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z9J9	0.0	561	425	0.572	0.647	D3Z9J9_RAT Patatin-like phospholipase domain containing 3 OS=Rattus norvegicus OX=10116 GN=Pnpla3 PE=1 SV=2
2	Q91WW7	0.0	554	413	0.574	0.668	PLPL3_MOUSE 1-acylglycerol-3-phosphate O-acyltransferase Pnpla3 OS=Mus musculus OX=10090 GN=Pnpla3 PE=1 SV=1
3	Q9NST1	0.0	983	481	1.000	1.000	PLPL3_HUMAN 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 OS=Homo sapiens OX=9606 GN=PNPLA3 PE=1 SV=2
4	Q6DHN9	7.14e-118	356	473	0.372	0.378	Q6DHN9_DANRE Patatin-like phospholipase domain-containing protein 2 OS=Danio rerio OX=7955 GN=zgc:92195 PE=2 SV=1
5	Q96AD5	2.95e-115	350	504	0.378	0.361	PLPL2_HUMAN Patatin-like phospholipase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PNPLA2 PE=1 SV=1
6	Q8BJ56	3.36e-114	347	486	0.374	0.370	PLPL2_MOUSE Patatin-like phospholipase domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pnpla2 PE=1 SV=1
7	P0C548	2.23e-113	344	478	0.372	0.374	PLPL2_RAT Patatin-like phospholipase domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Pnpla2 PE=1 SV=1
8	Q7Z6Z6	3.50e-90	283	429	0.328	0.368	PLPL5_HUMAN Patatin-like phospholipase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=PNPLA5 PE=1 SV=1
9	Q9VUH7	6.02e-69	230	507	0.279	0.264	Q9VUH7_DROME Brummer, isoform A OS=Drosophila melanogaster OX=7227 GN=bmm PE=2 SV=1
10	E1JI03	1.11e-68	231	553	0.235	0.204	E1JI03_DROME Brummer, isoform B OS=Drosophila melanogaster OX=7227 GN=bmm PE=4 SV=1
11	Q11186	3.36e-64	220	621	0.283	0.219	PLPL2_CAEEL Patanin-like phospholipase domain-containing protein atgl-1 OS=Caenorhabditis elegans OX=6239 GN=atgl-1 PE=1 SV=2
12	Q8T3F2	5.64e-64	222	751	0.281	0.180	Q8T3F2_CAEEL PNPLA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=atgl-1 PE=1 SV=1
13	Q8N8W4	3.33e-56	197	532	0.206	0.186	PLPL1_HUMAN Omega-hydroxyceramide transacylase OS=Homo sapiens OX=9606 GN=PNPLA1 PE=1 SV=3
14	Q3V1D5	3.56e-55	196	599	0.206	0.165	PLPL1_MOUSE Omega-hydroxyceramide transacylase OS=Mus musculus OX=10090 GN=Pnpla1 PE=1 SV=1
15	P41247	6.13e-46	162	253	0.177	0.336	PLPL4_HUMAN Patatin-like phospholipase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PNPLA4 PE=1 SV=3
16	Q386C0	0.015	39.7	321	0.067	0.100	Q386C0_TRYB2 PNPLA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1440 PE=4 SV=1
17	A0A182DWF2	0.26	36.2	494	0.052	0.051	A0A182DWF2_HUMAN thioredoxin-disulfide reductase OS=Homo sapiens OX=9606 GN=TXNRD2 PE=1 SV=1
18	Q9NNW7	0.28	36.2	524	0.052	0.048	TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TXNRD2 PE=1 SV=3
19	D3YTF8	0.29	36.2	501	0.052	0.050	D3YTF8_HUMAN thioredoxin-disulfide reductase OS=Homo sapiens OX=9606 GN=TXNRD2 PE=1 SV=3
20	A0A182DWF3	0.33	35.8	523	0.052	0.048	A0A182DWF3_HUMAN thioredoxin-disulfide reductase OS=Homo sapiens OX=9606 GN=TXNRD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01734 Patatin	2e-11	56.0	Patatin-like phospholipase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216180

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244289	0.980	Hormone-sensitive lipase
2	9606.ENSP00000309757	0.940	Lipoprotein lipase
3	9606.ENSP00000265052	0.932	Monoglyceride lipase
4	9606.ENSP00000299022	0.918	Hepatic triacylglycerol lipase
5	9606.ENSP00000374014	0.917	Transmembrane 6 superfamily member 2
6	9606.ENSP00000347581	0.902	Acylglycerol kinase, mitochondrial
7	9606.ENSP00000358223	0.873	Pancreatic lipase
8	9606.ENSP00000390849	0.872	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
9	9606.ENSP00000433933	0.865	Inactive pancreatic lipase-related protein 1
10	9606.ENSP00000358232	0.864	Pancreatic lipase related protein 3
11	9606.ENSP00000245615	0.860	Lysophospholipid acyltransferase 7
12	9606.ENSP00000377900	0.858	Lipase F, gastric type
13	9606.ENSP00000228027	0.855	Diacylglycerol O-acyltransferase 2
14	9606.ENSP00000482264	0.852	Diacylglycerol O-acyltransferase 1
15	9606.ENSP00000361151	0.849	Bile salt-activated lipase
16	9606.ENSP00000397908	0.845	Phosphatidate phosphatase LPIN1
17	9606.ENSP00000261292	0.835	Endothelial lipase
18	9606.ENSP00000337701	0.819	Patatin-like phospholipase domain-containing protein 2
19	9606.ENSP00000406674	0.768	2-acylglycerol O-acyltransferase 1
20	9606.ENSP00000355895	0.764	Lysophospholipase-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016411	1.000	acylglycerol O-acyltransferase activity
GO:0004806	1.000	triglyceride lipase activity
GO:0000062	1.000	fatty-acyl-CoA binding
GO:0004620	0.997	phospholipase activity
GO:0071617	0.996	lysophospholipid acyltransferase activity
GO:0005543	0.993	phospholipid binding
GO:0004623	0.992	phospholipase A2 activity
GO:0003841	0.990	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0004465	0.968	lipoprotein lipase activity
GO:0051265	0.858	diolein transacylation activity
GO:0051264	0.858	mono-olein transacylation activity
GO:0005515	0.840	protein binding
GO:0035727	0.794	lysophosphatidic acid binding
GO:0036042	0.794	long-chain fatty acyl-CoA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044255	0.987	cellular lipid metabolic process
GO:0046486	0.978	glycerolipid metabolic process
GO:0006638	0.975	neutral lipid metabolic process
GO:0006639	0.947	acylglycerol metabolic process
GO:0006641	0.942	triglyceride metabolic process
GO:0008610	0.927	lipid biosynthetic process
GO:0016042	0.920	lipid catabolic process
GO:0008654	0.903	phospholipid biosynthetic process
GO:0045017	0.901	glycerolipid biosynthetic process
GO:0006631	0.899	fatty acid metabolic process
GO:0046503	0.898	glycerolipid catabolic process
GO:0006650	0.897	glycerophospholipid metabolic process
GO:0046461	0.893	neutral lipid catabolic process
GO:0016043	0.877	cellular component organization
GO:0001676	0.854	long-chain fatty acid metabolic process
GO:0046474	0.850	glycerophospholipid biosynthetic process
GO:0046473	0.847	phosphatidic acid metabolic process
GO:0006654	0.823	phosphatidic acid biosynthetic process
GO:0046464	0.802	acylglycerol catabolic process
GO:0046463	0.760	acylglycerol biosynthetic process
GO:0034389	0.731	lipid droplet organization
GO:0019432	0.646	triglyceride biosynthetic process
GO:0065007	0.535	biological regulation
GO:0050789	0.478	regulation of biological process
GO:0050896	0.419	response to stimulus
GO:0050794	0.336	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0005811	1.000	lipid droplet
GO:0012505	0.996	endomembrane system
GO:0043227	0.991	membrane-bounded organelle
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0031090	0.947	organelle membrane
GO:0042175	0.939	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.918	organelle subcompartment
GO:0005789	0.904	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:12044	1.000	a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+)
EC:3.1.1.3	1.000	triacylglycerol lipase.
RHEA:15801	0.992	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	0.992	phospholipase A2.
RHEA:19709	0.990	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.990	1-acylglycerol-3-phosphate O-acyltransferase.
EC:3.1.1.34	0.968	lipoprotein lipase.

[back to server]