StarFunc result for job id Q9NSV4

User Input

>input (1193 residues)
MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKF
HLNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSEN
ELLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFI
HELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVK
KNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGE
ESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLH
IRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDV
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFT
YRKRLDLDLTQFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINEL
QAELQAFKSQFGALPADCNIPLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLP
GMRMPFSGPVPPPPPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMT
ENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELKFLDSKIA
QNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNL
CEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNF
VDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISA
KEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKRE
AEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRK
RTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNL
DTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARLRAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSV4	1.000	1.000	0.000	1193	1.000	1.000	Q9NSV4.pdb.gz	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
2	AFDB:O70566	0.730	0.791	5.598E-82	1098	0.515	0.559	O70566.pdb.gz	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
3	AFDB:F1RCU7	0.533	0.581	1.349E-76	1077	0.513	0.568	F1RCU7.pdb.gz
4	AFDB:P48608	0.387	0.415	3.188E-53	1091	0.327	0.357	P48608.pdb.gz	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
5	AFDB:Q80U19	0.459	0.486	1.407E-40	1115	0.232	0.248	Q80U19.pdb.gz	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
6	AFDB:A0A0R4IER9	0.380	0.417	3.086E-39	1060	0.251	0.282	A0A0R4IER9.pdb.gz	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
7	AFDB:Q54SP2	0.296	0.313	3.212E-39	1126	0.224	0.237	Q54SP2.pdb.gz	FORB_DICDI Formin-B OS=Dictyostelium discoideum OX=44689 GN=forB PE=1 SV=1
8	AFDB:Q9Y4D1	0.458	0.500	1.028E-38	1078	0.240	0.265	Q9Y4D1.pdb.gz	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
9	AFDB:A0A1D5P556	0.436	0.476	1.571E-37	1075	0.253	0.281	A0A1D5P556.pdb.gz	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
10	AFDB:Q54WH2	0.318	0.312	2.646E-37	1218	0.235	0.230	Q54WH2.pdb.gz	FORA_DICDI Formin-A OS=Dictyostelium discoideum OX=44689 GN=forA PE=1 SV=1
11	PDB:5tbkA	0.144	0.376	1.442E-3	417	0.038	0.108	5tbkA.pdb.gz
12	PDB:3tpoA	0.153	0.380	7.770E-3	438	0.032	0.087	3tpoA.pdb.gz
13	PDB:1wa5B	0.148	0.345	8.419E-3	466	0.032	0.082	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
14	PDB:2xwuB	0.106	0.129	1.071E-2	910	0.098	0.129	2xwuB.pdb.gz
15	PDB:3wyfC	0.108	0.119	1.160E-2	1040	0.074	0.085	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
16	PDB:2z6gA	0.147	0.300	1.257E-2	550	0.058	0.125	2z6gA.pdb.gz
17	PDB:3gb8A	0.140	0.169	1.599E-2	958	0.091	0.114	3gb8A.pdb.gz
18	PDB:1qgkA	0.122	0.154	2.034E-2	876	0.096	0.131	1qgkA.pdb.gz
19	PDB:6ahd1	0.110	0.121	2.034E-2	1048	0.093	0.106	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
20	PDB:7mp5A	0.083	0.067	2.486E-2	1629	0.087	0.064	7mp5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LVW7	0.0	1864	1172	0.822	0.837	DIAP3_RAT Protein diaphanous homolog 3 OS=Rattus norvegicus OX=10116 GN=Diaph3 PE=1 SV=4
2	O60879	0.0	587	1101	0.237	0.257	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
3	O70566	0.0	575	1098	0.239	0.260	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
4	Q9NSV4	0.0	2443	1193	1.000	1.000	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
5	Q9Z207	0.0	1883	1171	0.829	0.845	DIAP3_MOUSE Protein diaphanous homolog 3 OS=Mus musculus OX=10090 GN=Diaph3 PE=1 SV=1
6	O60610	3.28e-171	542	1272	0.231	0.217	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
7	F1M775	5.51e-169	536	1265	0.230	0.217	DIAP1_RAT Protein diaphanous homolog 1 OS=Rattus norvegicus OX=10116 GN=Diaph1 PE=1 SV=3
8	O08808	1.35e-167	532	1255	0.228	0.217	DIAP1_MOUSE Protein diaphanous homolog 1 OS=Mus musculus OX=10090 GN=Diaph1 PE=1 SV=1
9	F1RMT5	1.09e-123	404	850	0.187	0.262	F1RMT5_PIG Diaphanous related formin 1 OS=Sus scrofa OX=9823 GN=DIAPH1 PE=1 SV=5
10	P48608	8.59e-110	372	1091	0.158	0.173	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
11	Q7YZA4	5.84e-63	236	1114	0.196	0.210	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
12	Q8IRY0	7.45e-63	236	1153	0.196	0.203	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
13	M9MSM5	2.34e-62	236	1463	0.196	0.160	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
14	Q8MT16	7.88e-62	233	1114	0.196	0.210	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
15	Q5BII2	1.13e-57	219	1011	0.178	0.210	Q5BII2_DROME RE67944p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
16	Q9W5A4	1.31e-55	213	979	0.192	0.234	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
17	B3DJI0	1.89e-55	213	1069	0.123	0.138	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
18	A0A0R4IER9	3.11e-55	212	1060	0.127	0.142	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
19	Q5RHJ3	7.77e-54	207	1079	0.122	0.134	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
20	A0A1D5P556	2.76e-53	206	1075	0.127	0.141	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	71	15.2	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF06345 Drf_DAD	3.4	18.9	DRF Autoregulatory Domain
3	PF06367 Drf_FH3	1.4e-53	193.0	Diaphanous FH3 Domain
4	PF06371 Drf_GBD	2.5e-49	179.0	Diaphanous GTPase-binding Domain
5	PF10805 DUF2730	2.3e+02	13.3	Protein of unknown function (DUF2730)
6	PF19446 DUF5984	27	15.5	Family of unknown function (DUF5984)
7	PF02181 FH2	1.7e-110	381.3	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383178

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.996	Cell division control protein 42 homolog
2	9606.ENSP00000381565	0.972	Protein diaphanous homolog 1
3	9606.ENSP00000265748	0.960	Anillin
4	9606.ENSP00000365312	0.955	Abl interactor 1
5	9606.ENSP00000483313	0.948	Wiskott-Aldrich syndrome protein family member 2
6	9606.ENSP00000400175	0.924	Transforming protein RhoA
7	9606.ENSP00000354251	0.917	Nck-associated protein 1
8	9606.ENSP00000444645	0.917	Cytoplasmic FMR1-interacting protein 2
9	9606.ENSP00000256442	0.911	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000334061	0.909	Histone deacetylase 6
11	9606.ENSP00000316338	0.905	Brain-specific angiogenesis inhibitor 1-associated protein 2
12	9606.ENSP00000272233	0.892	Rho-related GTP-binding protein RhoB
13	9606.ENSP00000288207	0.875	G2/mitotic-specific cyclin-B2
14	9606.ENSP00000385757	0.815	Biliverdin reductase A
15	9606.ENSP00000287598	0.795	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
16	9606.ENSP00000428489	0.788	Lymphokine-activated killer T-cell-originated protein kinase
17	9606.ENSP00000361298	0.784	Kinesin-like protein KIF2C
18	9606.ENSP00000354468	0.769	NADH-cytochrome b5 reductase 3
19	9606.ENSP00000260731	0.765	Kinesin-like protein KIF11
20	9606.ENSP00000263368	0.764	Flavin reductase (NADPH)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0008092	0.478	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.985	cellular component organization
GO:0030029	0.957	actin filament-based process
GO:0006996	0.956	organelle organization
GO:0030036	0.950	actin cytoskeleton organization
GO:0065007	0.906	biological regulation
GO:0050789	0.894	regulation of biological process
GO:0007015	0.872	actin filament organization
GO:0050794	0.870	regulation of cellular process
GO:0044085	0.857	cellular component biogenesis
GO:0022607	0.842	cellular component assembly
GO:0008154	0.637	actin polymerization or depolymerization
GO:0051258	0.615	protein polymerization
GO:0030041	0.607	actin filament polymerization
GO:0032501	0.471	multicellular organismal process
GO:0048518	0.383	positive regulation of biological process
GO:0048522	0.348	positive regulation of cellular process
GO:0032502	0.335	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.996	membrane-bounded organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005634	0.984	nucleus
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0016020	0.592	membrane
GO:0070013	0.543	intracellular organelle lumen
GO:0031981	0.478	nuclear lumen
GO:0012505	0.353	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]