StarFunc result for job id Q9NSY1

User Input

>input (1161 residues)
MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEG
GFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSIS
DNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRD
LKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGG
KPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEP
DPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARKSQIKARITDT
IGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQ
QQQQQQHHHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQY
QQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
ADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSD
KNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSINQENGTANPIKNGKTSPASKD
QRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQGDFNDDDTEPE
NLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA
QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTK
APFSKKVNVQECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFD
EITGSQQQKVKQRSLQKLSSRQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARR
HKKVGRRDSQSSNEFLTISDSKENISVALTDGKDRGNVLQPEESLLDPFGAKPFHSPDLS
WHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKMDDFGAVPFTELVVQSITPHQ
SQQSQPVELDPFGAAPFPSKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91Z96	0.417	0.425	0.000	1138	0.829	0.846	Q91Z96.pdb.gz	BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus OX=10090 GN=Bmp2k PE=1 SV=1
2	AFDB:Q9NSY1	1.000	1.000	0.000	1161	1.000	1.000	Q9NSY1.pdb.gz	BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2
3	AFDB:F1SPM8	0.289	0.345	5.644E-58	968	0.319	0.382	F1SPM8.pdb.gz	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
4	AFDB:Q9VJ30	0.281	0.221	2.458E-53	1488	0.290	0.226	Q9VJ30.pdb.gz	Q9VJ30_DROME Numb-associated kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=2
5	AFDB:A0A0R4IWM3	0.237	0.216	2.577E-23	1278	0.204	0.185	A0A0R4IWM3.pdb.gz	A0A0R4IWM3_DANRE Cyclin G-associated kinase OS=Danio rerio OX=7955 GN=gak PE=1 SV=1
6	AFDB:P97874	0.237	0.211	3.376E-22	1305	0.206	0.183	P97874.pdb.gz	GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus OX=10116 GN=Gak PE=1 SV=1
7	PDB:2bujA	0.225	0.849	6.632E-22	291	0.066	0.265	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
8	AFDB:Q9VUQ9	0.190	0.107	1.014E-19	2139	0.155	0.084	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
9	AFDB:A1ZBC4	0.203	0.163	1.418E-19	1471	0.188	0.148	A1ZBC4.pdb.gz	A1ZBC4_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Sik3 PE=3 SV=2
10	AFDB:F1LP90	0.208	0.181	2.480E-19	1336	0.172	0.150	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
11	AFDB:A0A0R4IEP9	0.202	0.177	2.456E-18	1332	0.149	0.130	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
12	PDB:7myjC	0.203	0.483	1.249E-17	465	0.078	0.196	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
13	PDB:5u6yA	0.200	0.486	1.953E-17	459	0.069	0.174	5u6yA.pdb.gz
14	PDB:4rerA	0.203	0.491	4.002E-16	459	0.071	0.181	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:5ufuA	0.201	0.591	5.920E-16	369	0.063	0.198	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:6b1uA	0.204	0.508	6.261E-16	442	0.070	0.183	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4d28C	0.188	0.708	7.404E-16	279	0.070	0.290	4d28C.pdb.gz
18	PDB:4zhxA	0.201	0.538	9.793E-16	409	0.067	0.191	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:4eomC	0.197	0.763	1.036E-15	276	0.065	0.275	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:6s73A	0.191	0.767	1.370E-15	269	0.063	0.271	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SPM8	0.0	590	968	0.233	0.279	AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa OX=9823 GN=AAK1 PE=2 SV=2
2	H0Y9P1	0.0	1742	854	0.735	0.999	H0Y9P1_HUMAN BMP-2-inducible protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=1
3	P0C1X8	0.0	581	962	0.231	0.279	AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Aak1 PE=1 SV=1
4	Q3UHJ0	0.0	588	959	0.232	0.281	AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Aak1 PE=1 SV=2
5	Q91Z96	0.0	1721	1138	0.811	0.828	BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus OX=10090 GN=Bmp2k PE=1 SV=1
6	Q9NSY1	0.0	2410	1161	1.000	1.000	BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2
7	Q7KT38	1.78e-132	422	698	0.178	0.297	Q7KT38_DROME Numb-associated kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=1
8	X2J946	2.49e-132	422	708	0.178	0.292	X2J946_DROME Numb-associated kinase, isoform E OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=1
9	Q8MSQ7	9.98e-132	420	698	0.177	0.295	Q8MSQ7_DROME SD07306p OS=Drosophila melanogaster OX=7227 GN=Nak PE=2 SV=1
10	Q9VJ30	1.94e-126	425	1488	0.178	0.139	Q9VJ30_DROME Numb-associated kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Nak PE=1 SV=2
11	Q9U485	2.12e-126	425	1490	0.178	0.139	Q9U485_DROME Numb-associated kinase OS=Drosophila melanogaster OX=7227 GN=Nak PE=2 SV=1
12	O43066	6.63e-63	234	953	0.102	0.125	PPK30_SCHPO Serine/threonine-protein kinase ppk30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk30 PE=1 SV=1
13	Q9USS2	5.29e-62	231	872	0.102	0.136	PPK29_SCHPO Serine/threonine-protein kinase ppk29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk29 PE=1 SV=1
14	P53974	3.70e-60	221	638	0.101	0.183	ARK1_YEAST Actin-regulating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARK1 PE=1 SV=1
15	P40494	2.73e-58	218	810	0.095	0.136	PRK1_YEAST Actin-regulating kinase PRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRK1 PE=1 SV=1
16	P38080	7.33e-55	211	1108	0.096	0.101	AKL1_YEAST Serine/threonine-protein kinase AKL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AKL1 PE=1 SV=1
17	Q9UU85	2.09e-54	204	650	0.097	0.174	PPK38_SCHPO Protein kinase domain-containing protein ppk38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk38 PE=4 SV=1
18	O14976	3.70e-49	193	1311	0.107	0.095	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2
19	P97874	1.86e-48	191	1305	0.104	0.093	GAK_RAT Cyclin-G-associated kinase OS=Rattus norvegicus OX=10116 GN=Gak PE=1 SV=1
20	A0A0R4IWM3	2.19e-48	191	1278	0.098	0.089	A0A0R4IWM3_DANRE Cyclin G-associated kinase OS=Danio rerio OX=7955 GN=gak PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15282 BMP2K_C	2.7e-122	419.6	BMP-2-inducible protein kinase C-terminus
2	PF00069 Pkinase	6.7e-38	142.2	Protein kinase domain
3	PF17667 Pkinase_fungal	9.1	16.6	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1.4e-22	91.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334836

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392065	0.910	RalBP1-associated Eps domain-containing protein 1
2	9606.ENSP00000377015	0.909	Phosphatidylinositol-binding clathrin assembly protein
3	9606.ENSP00000451300	0.901	Protein numb homolog
4	9606.ENSP00000292807	0.893	AP-2 complex subunit mu
5	9606.ENSP00000479606	0.856	Clathrin heavy chain 1
6	9606.ENSP00000393313	0.818	Epidermal growth factor receptor substrate 15-like 1
7	9606.ENSP00000019317	0.757	RalA-binding protein 1
8	9606.ENSP00000252891	0.754	Numb-like protein
9	9606.ENSP00000417653	0.752	Drebrin-like protein
10	9606.ENSP00000441158	0.727	Clathrin heavy chain 2
11	9606.ENSP00000229243	0.698	Acrosin-binding protein
12	9606.ENSP00000360798	0.691	Epidermal growth factor receptor substrate 15
13	9606.ENSP00000480091	0.686	Nicotinamide riboside kinase 2
14	9606.ENSP00000393776	0.685	F-BAR domain only protein 2
15	9606.ENSP00000263270	0.683	AP-2 complex subunit sigma
16	9606.ENSP00000410862	0.677	RUN domain-containing protein 3A
17	9606.ENSP00000377633	0.675	STAM-binding protein
18	9606.ENSP00000360994	0.660	AMSH-like protease
19	9606.ENSP00000483453	0.659	Synergin gamma
20	9606.ENSP00000327694	0.655	AP-2 complex subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004672	1.000	protein kinase activity
GO:0030234	0.998	enzyme regulator activity
GO:0005515	0.996	protein binding
GO:0019208	0.990	phosphatase regulator activity
GO:0004674	0.967	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.916	cellular process
GO:0050794	0.678	regulation of cellular process
GO:0070167	0.455	regulation of biomineral tissue development
GO:0030278	0.453	regulation of ossification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.990	nucleoplasm
GO:0016604	0.357	nuclear body
GO:0071944	0.340	cell periphery
GO:0005737	0.319	cytoplasm
GO:0005829	0.308	cytosol
GO:0016607	0.302	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]