StarFunc result for job id Q9NSY2

User Input

>input (213 residues)
MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGT
LEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLV
LVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDL
SGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NSY2	1.000	1.000	9.977E-43	213	1.000	1.000	Q9NSY2.pdb.gz	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
2	PDB:2r55A	0.961	0.984	2.956E-37	208	0.958	0.981	2r55A.pdb.gz
3	PDB:6l1dA	0.878	0.933	1.307E-21	200	0.305	0.325	6l1dA.pdb.gz
4	AFDB:Q99JV5	0.896	0.853	4.198E-21	224	0.315	0.299	Q99JV5.pdb.gz	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
5	PDB:5brlA	0.883	0.896	5.235E-21	210	0.315	0.319	5brlA.pdb.gz
6	AFDB:Q96DR4	0.881	0.914	6.918E-21	205	0.305	0.317	Q96DR4.pdb.gz	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
7	AFDB:P49675	0.894	0.674	7.135E-18	285	0.230	0.172	P49675.pdb.gz	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
8	AFDB:P51557	0.902	0.683	1.112E-17	284	0.244	0.183	P51557.pdb.gz	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
9	AFDB:Q61542	0.874	0.428	4.710E-17	446	0.239	0.114	Q61542.pdb.gz	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
10	AFDB:Q9DG10	0.889	0.671	5.564E-17	285	0.211	0.158	Q9DG10.pdb.gz	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
11	AFDB:Q57ZK9	0.783	0.469	7.778E-15	369	0.207	0.119	Q57ZK9.pdb.gz	Q57ZK9_TRYB2 START domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.510 PE=4 SV=1
12	AFDB:J3QLM1	0.783	0.363	2.113E-14	475	0.202	0.091	J3QLM1.pdb.gz	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
13	AFDB:F4JSE7	0.745	0.241	1.117E-13	718	0.207	0.061	F4JSE7.pdb.gz	EDR2_ARATH Protein ENHANCED DISEASE RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=EDR2 PE=2 SV=1
14	PDB:6serA	0.730	0.643	3.683E-12	245	0.197	0.171	6serA.pdb.gz
15	PDB:1ln1A	0.741	0.773	2.367E-10	203	0.136	0.143	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
16	PDB:3nefA	0.495	0.562	4.149E-4	182	0.094	0.110	3nefA.pdb.gz	Functional mechanism of the ABA agonist pyrabactin
17	PDB:3w9rA	0.473	0.567	4.386E-4	171	0.113	0.140	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
18	PDB:3k3kB	0.472	0.535	7.641E-4	183	0.075	0.087	3k3kB.pdb.gz	Structural mechanism of abscisic acid binding and signaling by dimeric PYR1.
19	PDB:3ojiB	0.452	0.507	8.077E-4	185	0.108	0.124	3ojiB.pdb.gz	Complex Structures of the Abscisic Acid Receptor PYL3/RCAR13 Reveal a Unique Regulatory Mechanism
20	PDB:1ifvA	0.406	0.515	1.191E-3	155	0.103	0.142	1ifvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NSY2	4.18e-162	447	213	1.000	1.000	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
2	Q99JV5	1.70e-39	137	224	0.315	0.299	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
3	Q96DR4	7.76e-39	134	205	0.310	0.322	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
4	P51557	4.57e-16	77.0	284	0.249	0.187	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
5	P97826	2.50e-15	74.7	284	0.239	0.180	STAR_RAT Steroidogenic acute regulatory protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Star PE=1 SV=1
6	P49675	3.42e-15	74.3	285	0.239	0.179	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
7	Q9DG10	4.03e-12	65.9	285	0.221	0.165	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
8	Q14849	1.54e-11	65.1	445	0.188	0.090	STAR3_HUMAN StAR-related lipid transfer protein 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=2
9	Q61542	9.13e-11	62.8	446	0.197	0.094	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
10	J3QLM1	2.50e-07	52.4	475	0.160	0.072	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
11	Q57ZK9	5.32e-05	45.4	369	0.192	0.111	Q57ZK9_TRYB2 START domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.510 PE=4 SV=1
12	F4JSE7	0.002	41.2	718	0.178	0.053	EDR2_ARATH Protein ENHANCED DISEASE RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=EDR2 PE=2 SV=1
13	Q9NQZ5	0.94	32.7	370	0.122	0.070	STAR7_HUMAN StAR-related lipid transfer protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=STARD7 PE=1 SV=2
14	Q8R1R3	1.1	32.3	373	0.122	0.070	STAR7_MOUSE StAR-related lipid transfer protein 7, mitochondrial OS=Mus musculus OX=10090 GN=Stard7 PE=1 SV=2
15	D3ZXY9	1.2	32.0	200	0.122	0.130	D3ZXY9_RAT StAR-related lipid transfer domain containing 7 OS=Rattus norvegicus OX=10116 GN=Stard7 PE=4 SV=2
16	P10610	1.9	31.6	494	0.066	0.028	CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus OX=10116 GN=Cyp2g1 PE=2 SV=1
17	P9WJE1	2.2	31.6	392	0.056	0.031	ESPA_MYCTU ESX-1 secretion-associated protein EspA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=espA PE=1 SV=1
18	Q59PF0	2.7	31.2	337	0.070	0.045	Q59PF0_CANAL Elongation of fatty acids protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FEN1 PE=3 SV=1
19	Q39123	3.8	30.8	833	0.141	0.036	ATHB8_ARATH Homeobox-leucine zipper protein ATHB-8 OS=Arabidopsis thaliana OX=3702 GN=ATHB-8 PE=1 SV=1
20	A0A1D8PGU2	4.0	30.4	292	0.066	0.048	A0A1D8PGU2_CANAL Elongation of fatty acids protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FEN12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01852 START	4.6e-17	73.7	START domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268896	0.811	Phosphatidylcholine transfer protein
2	9606.ENSP00000303246	0.764	Acyl-coenzyme A thioesterase 12
3	9606.ENSP00000276297	0.719	Rho GTPase-activating protein 7
4	9606.ENSP00000360366	0.649	Acyl-coenzyme A thioesterase 11
5	9606.ENSP00000369862	0.643	Collagen type IV alpha-3-binding protein
6	9606.ENSP00000356297	0.620	Pleckstrin homology and RhoGEF domain containing G1
7	9606.ENSP00000363727	0.591	StAR-related lipid transfer protein 8
8	9606.ENSP00000477707	0.582	Oxysterols receptor LXR-alpha
9	9606.ENSP00000338785	0.573	StAR-related lipid transfer protein 13
10	9606.ENSP00000455826	0.560	Golgin A8 family member T
11	9606.ENSP00000338030	0.540	StAR-related lipid transfer protein 7, mitochondrial
12	9606.ENSP00000348069	0.539	Sterol regulatory element-binding protein 1
13	9606.ENSP00000290607	0.538	StAR-related lipid transfer protein 9
14	9606.ENSP00000423159	0.520	Golgin A8 family member O
15	9606.ENSP00000335247	0.519	START domain-containing protein 10
16	9606.ENSP00000367794	0.507	Sushi repeat-containing protein SRPX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0120020	1.000	cholesterol transfer activity
GO:0015485	1.000	cholesterol binding
GO:0005515	0.976	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010876	0.985	lipid localization
GO:0030301	0.972	cholesterol transport
GO:0009987	0.779	cellular process
GO:0050789	0.775	regulation of biological process
GO:0050794	0.737	regulation of cellular process
GO:0048518	0.305	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.915	organelle
GO:0043231	0.884	intracellular membrane-bounded organelle
GO:0031974	0.490	membrane-enclosed lumen
GO:0012505	0.421	endomembrane system
GO:0070013	0.388	intracellular organelle lumen
GO:0005634	0.362	nucleus
GO:0005739	0.302	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	1.000	cholesterol(in) = cholesterol(out)

[back to server]